Property Summary

NCBI Gene PubMed Count 106
PubMed Score 236.47
PubTator Score 216.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Disease of mental health 36 0.0 3.0

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical adenoma -1.567 1.8e-02
adrenocortical carcinoma -2.869 6.1e-10
aldosterone-producing adenoma -1.569 1.9e-02
cystic fibrosis -2.700 7.3e-07
ependymoma 1.400 9.9e-03
head and neck cancer -1.600 6.1e-03
interstitial cystitis 1.100 1.6e-03
intraductal papillary-mucinous adenoma (... -1.800 2.1e-02
lung adenocarcinoma -1.300 1.4e-07
lung cancer -1.700 4.7e-04
lung carcinoma -2.500 5.2e-18
mucosa-associated lymphoid tissue lympho... 1.422 5.9e-03
non diabetic and post-ischemic heart fai... 1.300 2.4e-03
non-small cell lung cancer -1.195 4.1e-06
osteosarcoma -2.936 3.4e-04
pancreatic ductal adenocarcinoma liver m... -2.009 2.3e-02
psoriasis 1.500 4.7e-03
sonic hedgehog group medulloblastoma 1.100 2.7e-03

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (79)

AA Sequence

MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFSNSSKEMMCFP      1 - 70
DFPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTERDGKKESAVF     71 - 140
DAVMVCSGHHVYPNLPKESFPGLNHFKGKCFHSRDYKEPGVFNGKRVLVVGLGNSGCDIATELSRTAEQV    141 - 210
MISSRSGSWVMSRVWDNGYPWDMLLVTRFGTFLKNNLPTAISDWLYVKQMNARFKHENYGLMPLNGVLRK    211 - 280
EPVFNDELPASILCGIVSVKPNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEI    281 - 350
ILFKGVFPPLLEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLPSMEDMMNDINEKMEKKRKWF    351 - 420
GKSETIQTDYIVYMDELSSFIGAKPNIPWLFLTDPKLAMEVYFGPCSPYQFRLVGPGQWPGARNAILTQW    421 - 490
DRSLKPMQTRVVGRLQKPCFFFHWLKLFAIPILLIAVFLVLT                                491 - 532
//

Text Mined References (109)

PMID Year Title