Property Summary

NCBI Gene PubMed Count 97
PubMed Score 219.15
PubTator Score 216.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 5.23365539895793E-18
lung adenocarcinoma 2714 3.57904482348266E-11
adrenocortical carcinoma 1427 1.4152973415113E-9
posterior fossa group B ependymoma 1530 2.30933811628836E-7
non-small cell lung cancer 2798 4.39873599504612E-7
cystic fibrosis 1670 5.96116793619007E-6
lung cancer 4473 3.02823430486688E-4
osteosarcoma 7933 4.24233323453053E-4
non diabetic and post-ischemic heart failure 200 0.00242555924735813
interstitial cystitis 2299 0.00246976565363298
sonic hedgehog group medulloblastoma 1482 0.00268499906676497
head and neck cancer 270 0.00382014892239444
psoriasis 6685 0.00470859551763422
mucosa-associated lymphoid tissue lymphoma 480 0.00591541374365036
aldosterone-producing adenoma 664 0.0147332312461415
adrenocortical adenoma 134 0.0198428295963852
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0209570515233282
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0225873962826558
Disease Target Count Z-score Confidence
Disease of mental health 22 0.0 2.0
Disease Target Count Z-score Confidence
Metabolic syndrome X 155 3.876 1.9
Delusional disorder 10 3.367 1.7
Disease Target Count
Trimethylaminuria 1

Expression

Synonym

Accession P31513 B2R816 Q14854 Q8N5N5
Symbols TMAU
FMOII
dJ127D3.1

Gene

PANTHER Protein Class (2)

  Ortholog (7)

 GWAS Trait (1)

Gene RIF (71)

PMID Text
26616280 Oxidative stress-responsive transcription factor NRF2 is not indispensable for the human hepatic Flavin-containing monooxygenase-3 (FMO3) gene expression in HepG2 cells
26519273 FMO3 gene polymorphism E158K is a significant predictor of predisposition to chronic heart disease in women.
26218418 FMO3 is centrally involved in the pathogenesis of atherosclerosis by regulating cholesterol metabolism and insulin resistance. [Review]
25849138 FMO3 expression is increased in obese/insulin resistant patients.
25760532 These results suggest that genetic polymorphism in the human FMO3 gene may lead to changes of drug interactions for N- or S-oxygenations of xenobiotics and endogenous substances.
25288227 Three polymorphisms were found in intronic regions of FMO3 in a child with trimethylaminuria and in her parents and a brother. The parents and brother showed no symptoms.
25224784 Effect of two-linked mutations of the FMO3 gene on itopride metabolism in Chinese healthy volunteers
24448396 results show that FMO3 E158K and POR A503V polymorphisms are minor sources of nicotine metabolism variation, insufficient to appreciably alter smoking.
24173915 FMO3 (rs2266780) was in complete linkage disequilibrium with FMO6.
24028545 Comparisons of genotype and phenotype reveal that severe trimethylaminuria is caused by loss of function mutations in FMO3
More...

AA Sequence

MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFSNSSKEMMCFP      1 - 70
DFPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTERDGKKESAVF     71 - 140
DAVMVCSGHHVYPNLPKESFPGLNHFKGKCFHSRDYKEPGVFNGKRVLVVGLGNSGCDIATELSRTAEQV    141 - 210
MISSRSGSWVMSRVWDNGYPWDMLLVTRFGTFLKNNLPTAISDWLYVKQMNARFKHENYGLMPLNGVLRK    211 - 280
EPVFNDELPASILCGIVSVKPNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEI    281 - 350
ILFKGVFPPLLEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLPSMEDMMNDINEKMEKKRKWF    351 - 420
GKSETIQTDYIVYMDELSSFIGAKPNIPWLFLTDPKLAMEVYFGPCSPYQFRLVGPGQWPGARNAILTQW    421 - 490
DRSLKPMQTRVVGRLQKPCFFFHWLKLFAIPILLIAVFLVLT                                491 - 532
//

Text Mined References (100)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26616280 2016 Oxidative stress-responsive transcription factor NRF2 is not indispensable for the human hepatic Flavin-containing monooxygenase-3 (FMO3) gene expression in HepG2 cells.
26519273 2015 Association of Flavin Monooxygenase Gene E158K Polymorphism with Chronic Heart Disease Risk.
26218418 2015 Emerging roles of flavin monooxygenase 3 in cholesterol metabolism and atherosclerosis.
25870212 2015 Fish Malodour syndrome in a child.
25849138 2015 Flavin-containing monooxygenase 3 as a potential player in diabetes-associated atherosclerosis.
25760532 2015 Potential for drug interactions mediated by polymorphic flavin-containing monooxygenase 3 in human livers.
25460299 2014 Regulation of flavin-containing mono-oxygenase (Fmo3) gene expression by steroids in mice and humans.
25288227 2014 Fish odor syndrome (trimethylaminuria) supporting the possible FMO3 down expression in childhood: a case report.
25224784 2014 Effect of two-linked mutations of the FMO3 gene on itopride metabolism in Chinese healthy volunteers.
More...