Property Summary

NCBI Gene PubMed Count 13
PubMed Score 21.20
PubTator Score 9.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease -1.044 6.0e-03
adult high grade glioma 1.900 7.0e-04
Astrocytoma, Pilocytic 1.200 2.2e-03
atypical teratoid / rhabdoid tumor 1.900 8.6e-06
ependymoma 1.500 1.2e-08
glioblastoma 1.200 2.9e-04
lung carcinoma -1.700 2.0e-27
medulloblastoma 1.400 1.6e-03
medulloblastoma, large-cell 2.100 4.9e-06
nephrosclerosis -1.015 1.1e-02
non diabetic and post-ischemic heart fai... 1.200 3.9e-03
ulcerative colitis -1.100 3.9e-05

Gene RIF (3)

AA Sequence

MAKKVAVIGAGVSGLSSIKCCVDEDLEPTCFERSDDIGGLWKFTESSKDGMTRVYKSLVTNVCKEMSCYS      1 - 70
DFPFHEDYPNFMNHEKFWDYLQEFAEHFDLLKYIQFKTTVCSITKRPDFSETGQWDVVTETEGKQNRAVF     71 - 140
DAVMVCTGHFLNPHLPLEAFPGIHKFKGQILHSQEYKIPEGFQGKRVLVIGLGNTGGDIAVELSRTAAQV    141 - 210
LLSTRTGTWVLGRSSDWGYPYNMMVTRRCCSFIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKKAK    211 - 280
FIVNDELPNCILCGAITMKTSVIEFTETSAVFEDGTVEENIDVVIFTTGYTFSFPFFEEPLKSLCTKKIF    281 - 350
LYKQVFPLNLERATLAIIGLIGLKGSILSGTELQARWVTRVFKGLCKIPPSQKLMMEATEKEQLIKRGVF    351 - 420
KDTSKDKFDYIAYMDDIAACIGTKPSIPLLFLKDPRLAWEVFFGPCTPYQYRLMGPGKWDGARNAILTQW    421 - 490
DRTLKPLKTRIVPDSSKPASMSHYLKAWGAPVLLASLLLICKSSLFLKLVRDKLQDRMSPYLVSLWRG      491 - 558
//

Text Mined References (14)

PMID Year Title