Property Summary

NCBI Gene PubMed Count 112
PubMed Score 255.62
PubTator Score 183.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
non-small cell lung carcinoma 413
Disease Target Count P-value
Breast cancer 3099 2.08186546382157E-12
non-small cell lung cancer 2798 2.50216583863628E-8
sonic hedgehog group medulloblastoma 1482 2.85134080920843E-7
atypical teratoid/rhabdoid tumor 1095 3.59095592337435E-7
ovarian cancer 8492 3.00281258170196E-6
lung cancer 4473 6.74702328262543E-6
interstitial cystitis 2299 2.33968402610263E-5
medulloblastoma, large-cell 6234 4.68430182209377E-5
psoriasis 6685 1.83829941319623E-4
pilocytic astrocytoma 3086 3.27739709764987E-4
adult high grade glioma 2148 5.54514578157329E-4
primitive neuroectodermal tumor 3031 0.00105659338871183
tuberculosis 1563 0.00157178905498411
glioblastoma 5572 0.00176021636172477
pancreatic cancer 2300 0.006452576038092
cutaneous lupus erythematosus 1056 0.00666907698829338
chronic rhinosinusitis 512 0.0083325510452171
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0111443542205744
primary pancreatic ductal adenocarcinoma 1271 0.0139698398324566
adrenocortical carcinoma 1427 0.0154217103788345
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0188484138039163
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0211084820115473
diabetes mellitus 1663 0.0228286019504695
esophageal adenocarcinoma 737 0.0251471834334106
invasive ductal carcinoma 2950 0.0266875309786404
primary Sjogren syndrome 789 0.0314786222349527
Gaucher disease type 1 171 0.0337729697343923
facioscapulohumeral dystrophy 286 0.0439229363315421
Disease Target Count Z-score Confidence
Degenerative disc disease 28 3.816 1.9
Cancer 2346 3.248 1.6

Expression

Synonym

Accession P31431 O00773 Q16833 Q53FN9 Q6FGN3 SYND4
Symbols SYND4

Gene

PDB

1OBY   1YBO   1EJP   1EJQ  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish EggNOG Inparanoid

Gene RIF (95)

PMID Text
26350464 demonstrate that HER2 is captured via a site, comprised of amino acids 210-240, in the extracellular domain of human Sdc1, and EGFR is captured via an extracellular site comprised of amino acids 87-131 in human Sdc4
26261514 Synd4 shedding is a molecular pathological alteration in the development and maintenance of inflammation-associated atrial fibrillation.
26254886 results suggest that SDC4 alleles affect lipid profile in elderly subjects and may in part mediate the link between LDL-C and longevity.
26160374 Syndecan-4 is essential for transmitting the mechanotransduction signals via activation of PKC-alpha and is important for tumor cells spreading, assembly of actin cytoskeleton and cell contractility.
25449226 define a role for TG2 activity at the surface of human macrophages in multiple stages of AC clearance and we propose that TG2, in association with heparan sulphates may exert its effect on AC clearance via a mechanism involving the crosslinking of CD44
25410619 Syndecan-4 polymorphisms were associated with essential hypertension, body mass index, and coronary artery disease prevalence in the Tampere adult population cardiovascular risk study.
25404299 Data indicate that depletion of syndecan 4 (S4) in umbilical vein endothelial cells (HUVECs) using shRNA inhibited flow-induced alignment in vitro, which was rescued by re-expression of S4.
25361632 No association was found with SDC4 and breast cancer.
25216363 Dynamic catch of a Thy-1-integrin alpha5beta1+syndecan-4 trimolecular complex explains extraordinary cancer cell adhesion to the vascular endothelium.
25202019 Sdc4 is necessary for activation of the integrin during chemokinesis induced by EGF.
More...

AA Sequence

MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLE      1 - 70
DSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNI     71 - 140
FERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSYDLGKKPIYKKAPTNEFYA                141 - 198
//

Text Mined References (120)

PMID Year Title
26350464 2015 Syndecan-1 and Syndecan-4 Capture Epidermal Growth Factor Receptor Family Members and the ?3?1 Integrin Via Binding Sites in Their Ectodomains: NOVEL SYNSTATINS PREVENT KINASE CAPTURE AND INHIBIT ?6?4-INTEGRIN-DEPENDENT EPITHELIAL CELL MOTILITY.
26261514 2015 Syndecan-4 shedding is involved in the oxidative stress and inflammatory responses in left atrial tissue with valvular atrial fibrillation.
26254886 2015 Metabolism and successful aging: Polymorphic variation of syndecan-4 (SDC4) gene associate with longevity and lipid profile in healthy elderly Italian subjects.
26160374 2015 Syndecan-4 Promotes Epithelial Tumor Cells Spreading and Regulates the Turnover of PKC? Activity under Mechanical Stimulation on the Elastomeric Substrates.
25449226 2015 Transglutaminase 2 interacts with syndecan-4 and CD44 at the surface of human macrophages to promote removal of apoptotic cells.
25416956 2014 A proteome-scale map of the human interactome network.
25410619 2014 Contribution of syndecan-4 genetic variants to hypertension, the TAMRISK study.
25404299 2014 Syndecan 4 is required for endothelial alignment in flow and atheroprotective signaling.
25361632 2015 Association of heparan sulfate proteoglycans SDC1 and SDC4 polymorphisms with breast cancer in an Australian Caucasian population.
25216363 2014 Dynamic catch of a Thy-1-?5?1+syndecan-4 trimolecular complex.
More...