Property Summary

NCBI Gene PubMed Count 121
PubMed Score 274.79
PubTator Score 183.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
adrenocortical carcinoma -1.254 1.5e-02
adult high grade glioma -2.200 5.5e-04
Astrocytoma, Pilocytic -1.600 3.0e-04
atypical teratoid / rhabdoid tumor -2.600 1.7e-05
Breast cancer -1.500 2.1e-12
chronic rhinosinusitis -1.080 8.3e-03
cutaneous lupus erythematosus -1.400 6.7e-03
diabetes mellitus -1.400 2.3e-02
esophageal adenocarcinoma 1.300 2.5e-02
facioscapulohumeral dystrophy -1.200 4.4e-02
Gaucher disease type 1 -1.300 3.4e-02
glioblastoma -1.400 1.8e-03
group 3 medulloblastoma -3.200 3.9e-04
interstitial cystitis -1.200 4.9e-04
intraductal papillary-mucinous adenoma (... 1.700 1.1e-02
intraductal papillary-mucinous carcinoma... 1.700 1.9e-02
intraductal papillary-mucinous neoplasm ... 2.100 2.1e-02
invasive ductal carcinoma 1.400 2.7e-02
lung cancer -1.800 6.7e-04
medulloblastoma, large-cell -3.600 4.7e-05
non-small cell lung cancer -1.131 2.5e-08
ovarian cancer -1.400 3.7e-04
pancreatic cancer 1.200 1.1e-06
primary pancreatic ductal adenocarcinoma 1.274 1.4e-02
primary Sjogren syndrome -1.600 3.1e-02
primitive neuroectodermal tumor -2.300 1.1e-03
psoriasis -1.800 1.8e-04
tuberculosis -1.900 1.6e-03

Gene RIF (104)

AA Sequence

MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLE      1 - 70
DSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNI     71 - 140
FERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSYDLGKKPIYKKAPTNEFYA                141 - 198
//

Text Mined References (129)

PMID Year Title