Property Summary

NCBI Gene PubMed Count 30
PubMed Score 86.83
PubTator Score 39.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy -1.900 1.2e-06
Astrocytoma, Pilocytic -1.300 1.5e-04
glioblastoma -1.100 4.3e-03
group 3 medulloblastoma -2.300 4.5e-04
medulloblastoma, large-cell -1.500 5.5e-04
pediatric high grade glioma -1.100 7.0e-03
primitive neuroectodermal tumor -1.600 4.8e-04
psoriasis -1.400 1.4e-29

Gene RIF (20)

AA Sequence

MSATDRMGPRAVPGLRLALLLLLVLGTPKSGVQGQEGLDFPEYDGVDRVINVNAKNYKNVFKKYEVLALL      1 - 70
YHEPPEDDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKKLGLTEVDSMYVFKGDEVIEY     71 - 140
DGEFSADTIVEFLLDVLEDPVELIEGERELQAFENIEDEIKLIGYFKSKDSEHYKAFEDAAEEFHPYIPF    141 - 210
FATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVNFVEEHRRSTLRKLKPESMYETWEDDM    211 - 280
DGIHIVAFAEEADPDGFEFLETLKAVAQDNTENPDLSIIWIDPDDFPLLVPYWEKTFDIDLSAPQIGVVN    281 - 350
VTDADSVWMEMDDEEDLPSAEELEDWLEDVLEGEINTEDDDDDDDD                            351 - 396
//

Text Mined References (32)

PMID Year Title