Property Summary

Ligand Count 82
NCBI Gene PubMed Count 48
PubMed Score 44.82
PubTator Score 44.49

Knowledge Summary

Patent (7,607)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Status Epilepticus 98 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Adenoma 167 3.515 1.8
Pituitary adenoma 38 3.021 1.5

Expression

 HCA RNA Cell Line (2)

Gene RIF (24)

AA Sequence

MSAPSTLPPGGEEGLGTAWPSAANASSAPAEAEEAVAGPGDARAAGMVAIQCIYALVCLVGLVGNALVIF      1 - 70
VILRYAKMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCRAVLSVDGLNMFTSVFCLTVL     71 - 140
SVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLPIAIFADTRPARGGQAVACNLQWPHPAWSAV    141 - 210
FVVYTFLLGFLLPVLAIGLCYLLIVGKMRAVALRAGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQL    211 - 280
LNLFVTSLDATVNHVSLILSYANSCANPILYGFLSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATA    281 - 350
LKSKGGAGCMCPPLPCQQEALQPEPGRKRIPLTRTTTF                                    351 - 388
//

Text Mined References (48)

PMID Year Title