Property Summary

NCBI Gene PubMed Count 48
PubMed Score 43.93
PubTator Score 44.49

Knowledge Summary

Patent (7,607)


  Disease Sources (3)


Accession P31391 Q17RM1 Q17RM3 Q9UIY1 SS-4-R
Symbols SS4R


  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Chicken OMA Inparanoid

  TechDev Info (1)

 HCA RNA Cell Line (2)

Gene RIF (24)

26474434 Data showed that the distribution of somatostatin receptor (SSTR) subtypes among the 199 pancreatic neuroendocrine tumors (PNETs) was: SSTR2 (54.8%), SSTR1 (53.3%), SSTR4 (51.8%), SSTR5 (33.7%), and SSTR3 (28.6%).
25962406 An immunohistochemical investigation of the expression of somatostatin receptor subtypes
24743707 this study shows that CD26 is associated with SSTR4 in malignant pleural mesothelioma cells, and this interaction inhibits SSTR4-mediated cytostatic effects.
24602981 deregulated somatostatin signaling in the Alzheimer disease cortices studied cannot be explained by hypermethylation of the SST or SSTR4 promoter CpG islands.
23991955 High SSTR4 expression is associated with lymph node metastasis in gallbladder cancer.
20810604 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20717067 Data show that the mRNA levels of SSTR1, SSTR2, SSTR3, and SSTR5 were high in PET compared with AC, whereas the expression of SSTR4 was low in PET and AC.
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

LKSKGGAGCMCPPLPCQQEALQPEPGRKRIPLTRTTTF                                    351 - 388

Text Mined References (48)

PMID Year Title
26474434 2016 Prognostic Value of Somatostatin Receptor Subtypes in Pancreatic Neuroendocrine Tumors.
25962406 2015 An immunohistochemical investigation of the expression of somatostatin receptor subtypes - should therapeutic trials be performed to determine the efficacy of somatostatin analogs in treating advanced thyroid malignances?
24743707 2014 Regulation of somatostatin receptor 4-mediated cytostatic effects by CD26 in malignant pleural mesothelioma.
24602981 2014 Methylation analysis of SST and SSTR4 promoters in the neocortex of Alzheimer's disease patients.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
23991955 2013 Somatostatin receptors 3, 4 and 5 play important roles in gallbladder cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20810604 2010 Eighteen insulin-like growth factor pathway genes, circulating levels of IGF-I and its binding protein, and risk of prostate and breast cancer.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20717067 2010 Profiling of somatostatin receptor subtype expression by quantitative PCR and correlation with clinicopathological features in pancreatic endocrine tumors.