Property Summary

NCBI Gene PubMed Count 71
PubMed Score 217.75
PubTator Score 389.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (24)

Disease log2 FC p
active ulcerative colitis -1.653 1.1e-02
adult high grade glioma -1.900 2.6e-03
astrocytic glioma -1.500 1.2e-02
Astrocytoma, Pilocytic -3.400 6.7e-12
atypical teratoid / rhabdoid tumor -1.700 2.7e-02
Breast cancer -1.300 4.2e-02
colon cancer -2.000 3.2e-03
Down syndrome -1.300 1.2e-03
ependymoma -2.100 2.1e-06
glioblastoma -2.200 3.4e-06
group 3 medulloblastoma -1.500 2.0e-02
head and neck cancer and chronic obstruc... -1.200 5.7e-04
interstitial cystitis -2.400 3.5e-03
intraductal papillary-mucinous neoplasm ... 1.100 4.2e-02
invasive ductal carcinoma -1.100 6.8e-03
lung cancer 1.900 8.8e-05
medulloblastoma, large-cell -1.500 4.6e-02
oligodendroglioma -1.100 4.4e-02
osteosarcoma -1.474 4.2e-06
ovarian cancer -4.000 5.6e-08
pituitary cancer -4.600 5.9e-14
psoriasis 1.300 2.6e-03
subependymal giant cell astrocytoma -2.343 3.4e-02
tuberculosis -1.600 1.8e-06

Protein-protein Interaction (9)

Gene RIF (42)

AA Sequence

MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRT      1 - 70
GFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQF     71 - 140
EENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS      141 - 208
//

Text Mined References (72)

PMID Year Title