Property Summary

NCBI Gene PubMed Count 65
Grant Count 68
R01 Count 47
Funding $5,297,374.14
PubMed Score 201.54
PubTator Score 389.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
astrocytoma -1.700 0.025
oligodendroglioma -1.100 0.044
psoriasis -1.400 0.000
glioblastoma -3.100 0.000
osteosarcoma -1.474 0.000
posterior fossa group B ependymoma -2.400 0.000
atypical teratoid / rhabdoid tumor -1.700 0.027
medulloblastoma, large-cell -2.400 0.026
active ulcerative colitis -1.653 0.011
tuberculosis -1.600 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.042
colon cancer -2.000 0.003
lung cancer 1.900 0.000
interstitial cystitis -3.500 0.000
pediatric high grade glioma -2.600 0.000
group 3 medulloblastoma -1.500 0.020
pilocytic astrocytoma -3.400 0.000
subependymal giant cell astrocytoma -2.343 0.034
Breast cancer -1.300 0.042
invasive ductal carcinoma -1.100 0.007
ovarian cancer -4.000 0.000
pituitary cancer -4.600 0.000
Down syndrome -1.300 0.001
head and neck cancer and chronic obstruc... -1.200 0.001

Synonym

Accession P31371 A8K427 Q3SY32 FGF-9
Symbols GAF
FGF-9
SYNS3
HBFG-9
HBGF-9

Gene

PANTHER Protein Class (2)

PDB

1G82   1IHK  

Gene RIF (36)

PMID Text
26351673 the relative levels of FGF9 in relation to other members of the FGF family may prove key to understanding vulnerability or resilience in affective disorders.
26183774 Data indicate that expressing either human FGF9 in the kidney subcapsular space of female BALB/c mice yielded rapidly expanding local tumors.
25978641 These studies identify FGF9 as a target of DICER1 in lung epithelium that functions as an initiating factor for pleuropulmonary blastoma.
25925261 FGF9 was strongly expressed in CAFs in comparison with NGFs, being compatible with microarray data indicating that FGF9 was a novel growth factor overexpressed in Cancer-associated fibroblasts
25907862 our data demonstrate that FGF9 can initiate a complex astrocytic response predicted to compromise remyelination, while at the same time stimulating microglial/macrophage recruitment in multiple sclerosis lesions
25766327 we found that Kl treatment impairs Nodal mRNA expression and Fgf9-mediated Nanos2 induction, reinforcing the antagonistic effect of these two growth factors on the meiotic fate of male germ cells
24511001 FGF9 can be associated with epithelial-to-mesenchymal transition and invasion by inducing VEGF-A expression in prostate cancer cells.
24334956 The data demonstrates that FGF9 IRES functions as a cellular switch to turn FGF9 protein synthesis 'on' during hypoxia, a likely mechanism underlying FGF9 overexpression in cancer cells.
24239165 expression is associated with poor prognosis in lung cancer
24135036 MAP3K1 mutations tilt the balance in the sex-determining pathways by downregulating SOX9 and FGF9.
More...

AA Sequence

MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRT      1 - 70
GFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQF     71 - 140
EENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS      141 - 208
//

Text Mined References (66)

PMID Year Title
26351673 2015 Fibroblast growth factor 9 is a novel modulator of negative affect.
26183774 2015 Fibroblast Growth Factor 9 Imparts Hierarchy and Vasoreactivity to the Microcirculation of Renal Tumors and Suppresses Metastases.
25978641 2015 Fibroblast Growth Factor 9 Regulation by MicroRNAs Controls Lung Development and Links DICER1 Loss to the Pathogenesis of Pleuropulmonary Blastoma.
25925261 2015 FGF9 from cancer-associated fibroblasts is a possible mediator of invasion and anti-apoptosis of gastric cancer cells.
25907862 2015 Fibroblast growth factor signalling in multiple sclerosis: inhibition of myelination and induction of pro-inflammatory environment by FGF9.
25766327 2015 Fgf9 inhibition of meiotic differentiation in spermatogonia is mediated by Erk-dependent activation of Nodal-Smad2/3 signaling and is antagonized by Kit Ligand.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24511001 2014 Accumulation of FGF9 in prostate cancer correlates with epithelial-to-mesenchymal transition and induction of VEGF-A expression.
24334956 2014 Overexpression of FGF9 in colon cancer cells is mediated by hypoxia-induced translational activation.
24239165 2014 Expression of fibroblast growth factor 9 is associated with poor prognosis in patients with resected non-small cell lung cancer.
More...