Property Summary

NCBI Gene PubMed Count 33
Grant Count 63
R01 Count 8
Funding $14,261,633.7
PubMed Score 526.03
PubTator Score 487.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
nephrosclerosis 1.511 0.013
Waldenstrons macroglobulinemia 1.838 0.038
cutaneous lupus erythematosus 1.700 0.018
psoriasis -1.700 0.004
osteosarcoma -4.231 0.000
atypical teratoid / rhabdoid tumor 1.400 0.036
chronic kidney disease 1.200 0.026
tuberculosis 1.400 0.000
non-small cell lung cancer -3.127 0.000
colon cancer -1.500 0.022
lung cancer -5.800 0.000
pancreatic cancer 1.100 0.044
breast carcinoma 1.100 0.045
interstitial cystitis 2.700 0.002
adult high grade glioma 1.300 0.019
primary Sjogren syndrome 1.300 0.001
lung adenocarcinoma -2.533 0.000
invasive ductal carcinoma 1.970 0.004
nasopharyngeal carcinoma -1.400 0.024
lung carcinoma -3.800 0.000
ductal carcinoma in situ 2.100 0.019
ulcerative colitis 2.500 0.000
ovarian cancer -1.900 0.000
pituitary cancer 2.000 0.004
head and neck cancer -1.500 0.021
head and neck cancer and chronic obstruc... 1.100 0.018

Gene RIF (17)

PMID Text
24799522 CD52 is a novel prognostic NSC marker and a potential NSC target in a subset of patients with MDS and AML, which may have clinical implications and may explain clinical effects produced by alemtuzumab in these patients.
22491736 A molecular and computational diagnostic approach identifies FOXP3, ICOS, CD52 and CASP1 as the most informative biomarkers in acute graft-versus-host disease.
22386526 carbohydrate moiety of sperm protein interferes with the complement system via binding to C1q
21552305 CT60 single-nucleotide polymorphism of CTLA4 is a surrogate marker for donor lymphocyte infusion outcome after allogeneic cell transplantation for acute leukemia
20349607 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20349607 Our bioinformatics findings suggest that CD52 polymorphism may affect the efficiency of GPI anchor formation and thus may indirectly alter the response to anti-CD52 agents like alemtuzumabin renal transplantation.
19794084 Clonal large granular lymphocytes exhibited decreased CD52 expression post-therapy in patients refractory to treatment.
18647288 We first showed the expression of CD52 in human cumulus cells. CD52 has some functional roles around fertilization in females as well as in males.
17624925 The semenogelin-CD52 soluble form is a direct consequence of the liquefaction process in human semen.
17428002 Our data demonstrate differences in the intensity of the CD52 antigen expression between B-lymphocytes and tumor lymphocytes of B-CLL patients, and between B-CLL and SLL tumor cells. CD52 antigen is expressed at low level on CD34(+) cells.
More...

AA Sequence

MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS               1 - 61
//

Text Mined References (34)

PMID Year Title
24799522 2014 Identification of campath-1 (CD52) as novel drug target in neoplastic stem cells in 5q-patients with MDS and AML.
22491736 2012 A molecular and computational diagnostic approach identifies FOXP3, ICOS, CD52 and CASP1 as the most informative biomarkers in acute graft-versus-host disease.
22386526 2012 The N-linked carbohydrate moiety of male reproductive tract CD52 (mrt-CD52) interferes with the complement system via binding to C1q.
21552305 2012 CT60 single-nucleotide polymorphism as a surrogate marker for donor lymphocyte infusion outcome after allogeneic cell transplantation for acute leukemia.
20349607 2009 CD52 gene polymorphism and its potential effect on the response to alemtuzumab in renal transplant recipients.
19794084 2009 Therapeutic implications of variable expression of CD52 on clonal cytotoxic T cells in CD8+ large granular lymphocyte leukemia.
18647288 2008 CD52 is synthesized in cumulus cells and secreted into the cumulus matrix during ovulation.
17624925 2008 The GPI-anchored CD52 antigen of the sperm surface interacts with semenogelin and participates in clot formation and liquefaction of human semen.
17428002 2007 Different levels of CD52 antigen expression evaluated by quantitative fluorescence cytometry are detected on B-lymphocytes, CD 34+ cells and tumor cells of patients with chronic B-cell lymphoproliferative diseases.
17145843 2006 Heterogeneous CD52 expression among hematologic neoplasms: implications for the use of alemtuzumab (CAMPATH-1H).
More...