Property Summary

NCBI Gene PubMed Count 78
PubMed Score 381.80
PubTator Score 623.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 4.33929989131317E-55
breast carcinoma 1614 7.01956574879781E-47
glioblastoma 5572 1.97791670784755E-14
atypical teratoid/rhabdoid tumor 1095 2.80768931587983E-13
posterior fossa group A ependymoma 1511 2.49122753631703E-11
group 3 medulloblastoma 2254 3.52745481289166E-11
pediatric high grade glioma 2712 2.14537458413379E-10
medulloblastoma, large-cell 6234 1.76211822095186E-8
lung adenocarcinoma 2714 3.42482355957986E-8
astrocytoma 1493 5.77618768353216E-8
primitive neuroectodermal tumor 3031 7.97549534647917E-8
ulcerative colitis 2087 1.76036706495157E-7
oligodendroglioma 2849 2.4588124513741E-7
adrenocortical carcinoma 1427 5.2117310419714E-7
tuberculosis 1563 1.07221054748501E-6
pancreatic cancer 2300 1.5554589585155E-5
pilocytic astrocytoma 3086 2.68955498727377E-5
Atopic dermatitis 944 7.66965450767947E-5
lung cancer 4473 1.21880806602792E-4
ductal carcinoma in situ 1745 1.31862650600243E-4
invasive ductal carcinoma 2950 1.33213907612412E-4
nasopharyngeal carcinoma 1056 1.38949235465526E-4
primary Sjogren syndrome 789 1.96128426051338E-4
hepatocellular carcinoma 550 0.00129169434736975
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00150323399071867
gastric cancer 436 0.0019194698933567
cutaneous lupus erythematosus 1056 0.00255055259338861
ovarian cancer 8492 0.00268296239201314
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00651507682383203
active Crohn's disease 918 0.00694086554043727
interstitial cystitis 2299 0.00880638034578371
Endometriosis 535 0.00919542324183228
pancreatic carcinoma 567 0.016486333089443
cystic fibrosis and chronic rhinosinusitis 213 0.0211365476387727
Breast cancer 3099 0.0215510499526643
colon cancer 1475 0.0218446147927136
esophageal adenocarcinoma 737 0.0301112460770327
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0370062404383051
chronic rhinosinusitis 512 0.0414597685620518

Expression

Synonym

Accession P31350 B2R9B5 J3KP43 Q5WRU7
Symbols R2
RR2
RR2M

Gene

PANTHER Protein Class (2)

PDB

2UW2   3OLJ   3VPM   3VPN   3VPO  

  Ortholog (12)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (65)

PMID Text
27348973 our findings establish a signaling role for RRM2 in gastric cancer cells and identify that the RRM2/AKT/NF-kappaB signaling pathway is essential for tumor invasiveness in gastric cancer cells
26921499 We suggest that MNNG-stimulated ATR/CHK1 signaling stabilizes E2F3 by S124 phosphorylation, and then E2F3 together with NFY co-transactivate RRM2 expression for DNA repair.
26718430 A significant association has been found between RRM2 rs6759180 (located in the 5'UTR, 10126436G>A) and the risk for developing non-small cell lung cancer.
26663950 High expression level of RRM2 might be negative prognostic factor for resected NSCLC patients.
26333382 Data show that ribonucleotide reductase M2 (RRM2) is associated with increased nuclear factor kappa B (NF-kappaB) activity.
26093293 Understanding the role of E2F1 in activating RRM2 transcription will help to explain the relationship between E2F1 and RRM2 in colorectal cancer
26026873 HBV exploits the Chk1-E2F1 axis of the DNA damage response pathway to induce R2 expression in a cell cycle-independent manner.
26001082 In non-small cell lung cancer, RRM2 expression was predictive of disease-specific survival in women, non-smokers and former smokers. Higher expression was associated with worse survival. This was not the case for men, and current or recently quit smokers.
25980818 The SCYL1- BP1 affects the cell cycle through increasing steady state levels of Cyclin F and RRM2 proteins, thus constituting a dual regulatory circuit.
25878246 R2 and p53R2 small subunits are subject to caspase-dependent degradation
More...

AA Sequence

MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDE      1 - 70
PLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGI     71 - 140
VNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWA    141 - 210
LRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHL    211 - 280
VHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM    281 - 350
ENISLEGKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF                                   351 - 389
//

Text Mined References (88)

PMID Year Title
27348973 2016 Overexpression of RRM2 in gastric cancer cell promotes their invasiveness via AKT/NF-?B signaling pathway.
26921499 2016 ATR-CHK1-E2F3 signaling transactivates human ribonucleotide reductase small subunit M2 for DNA repair induced by the chemical carcinogen MNNG.
26718430 2015 Investigation of some DNA repair genes association in non small cell lung cancer.
26663950 2015 Expression of Ribonucleotide Reductase Subunit-2 and Thymidylate Synthase Correlates with Poor Prognosis in Patients with Resected Stages I-III Non-Small Cell Lung Cancer.
26333382 2015 Targeting Ribonucleotide Reductase M2 and NF-?B Activation with Didox to Circumvent Tamoxifen Resistance in Breast Cancer.
26093293 2015 E2F1 promote the aggressiveness of human colorectal cancer by activating the ribonucleotide reductase small subunit M2.
26026873 2015 Hepatitis B virus induces RNR-R2 expression via DNA damage response activation.
26001082 2015 Ribonucleotide reductase subunit M2 predicts survival in subgroups of patients with non-small cell lung carcinoma: effects of gender and smoking status.
25980818 2016 SCYL1-BP1 affects cell cycle arrest in human hepatocellular carcinoma cells via Cyclin F and RRM2.
25878246 2015 Caspase-dependent Proteolysis of Human Ribonucleotide Reductase Small Subunits R2 and p53R2 during Apoptosis.
More...