Property Summary

Ligand Count 9
NCBI Gene PubMed Count 85
PubMed Score 405.90
PubTator Score 623.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Liver carcinoma 240
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (40)

Disease log2 FC p
active Crohn's disease 1.366 5.2e-03
adrenocortical carcinoma 3.756 5.2e-07
adult high grade glioma 4.200 1.5e-05
astrocytoma 1.700 5.8e-08
Astrocytoma, Pilocytic 2.200 3.2e-05
Atopic dermatitis 2.100 1.0e-05
atypical teratoid / rhabdoid tumor 4.000 5.0e-09
Breast cancer 4.900 2.2e-02
breast carcinoma 1.100 1.3e-05
chronic rhinosinusitis 1.056 4.1e-02
colon cancer 2.200 2.2e-02
cutaneous lupus erythematosus 2.000 2.6e-03
cystic fibrosis and chronic rhinosinusit... 1.156 2.1e-02
ductal carcinoma in situ 4.800 1.3e-04
Endometriosis 2.176 2.1e-02
ependymoma 3.000 3.0e-10
esophageal adenocarcinoma 1.800 3.0e-02
gastric cancer 1.100 1.9e-03
glioblastoma 5.000 2.0e-14
group 3 medulloblastoma 6.300 3.5e-11
hepatocellular carcinoma 1.100 1.3e-03
interstitial cystitis 2.900 4.6e-03
intraductal papillary-mucinous carcinoma... 4.100 1.5e-03
intraductal papillary-mucinous neoplasm ... 4.600 6.5e-03
invasive ductal carcinoma 5.300 1.3e-04
lung adenocarcinoma 1.300 3.7e-11
lung cancer 5.000 1.3e-06
medulloblastoma, large-cell 5.600 1.8e-08
nasopharyngeal carcinoma 1.600 1.4e-04
non-small cell lung cancer 3.972 8.3e-35
oligodendroglioma 2.100 2.5e-07
ovarian cancer 2.200 1.1e-03
pancreatic cancer 1.600 1.6e-02
pancreatic carcinoma 1.600 1.6e-02
pancreatic ductal adenocarcinoma liver m... 1.447 3.7e-02
primary Sjogren syndrome 2.200 2.0e-04
primitive neuroectodermal tumor 4.900 8.0e-08
psoriasis 2.000 7.6e-08
tuberculosis 2.000 4.4e-05
ulcerative colitis 1.800 1.3e-06

Protein-protein Interaction (5)

Gene RIF (70)

AA Sequence

MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDE      1 - 70
PLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGI     71 - 140
VNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWA    141 - 210
LRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHL    211 - 280
VHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM    281 - 350
ENISLEGKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF                                   351 - 389
//

Text Mined References (95)

PMID Year Title