Property Summary

NCBI Gene PubMed Count 78
Grant Count 163
R01 Count 65
Funding $60,708,960.36
PubMed Score 381.80
PubTator Score 623.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (56)

Disease Z-score Confidence
relapsing-remitting multiple sclerosis 18 5.333 2.7
Cancer 2,346 4.022 2.0
Atrial Fibrillation 110 3.559 1.8
Acute lymphoid leukemia 25
Adenocarcinoma of pancreas 12
Atopic dermatitis 944
Breast cancer 3,094
Chronic myeloid leukemia 11
Colorectal Neoplasms 217
Endometriosis 535
Hb SS disease 2
Hemoglobin SS disease with crisis 2
IGA Glomerulonephritis 454
Liver carcinoma 217
Malignant melanoma 2
Malignant tumor of head and/or neck 15
Malignant tumor of ovary 25
Metastatic Breast Carcinoma 21
Polycystic Ovary Syndrome 332
active Crohn's disease 918
adrenocortical carcinoma 1,427
astrocytoma 1,493
atypical teratoid/rhabdoid tumor 1,095
breast carcinoma 1,614
chronic rhinosinusitis 512
colon cancer 1,475
cutaneous lupus erythematosus 1,056
cystic fibrosis and chronic rhinosinusit... 213 
ductal carcinoma in situ 1,745
esophageal adenocarcinoma 737
gastric cancer 430
glioblastoma 5,572
group 3 medulloblastoma 2,254
hepatocellular carcinoma 532
interstitial cystitis 2,299
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
non-small cell lung cancer 2,798
oligodendroglioma 2,849
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic carcinoma 567
pancreatic ductal adenocarcinoma liver m... 1,795 
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
primary Sjogren syndrome 789
primitive neuroectodermal tumor 3,031
psoriasis 6,685
tuberculosis 1,557
ulcerative colitis 2,087

Expression

Synonym

Accession P31350 B2R9B5 J3KP43 Q5WRU7
Symbols R2
RR2
RR2M

Gene

PANTHER Protein Class (2)

PDB

2UW2   3OLJ   3VPM   3VPN   3VPO  

Gene RIF (65)

PMID Text
27348973 our findings establish a signaling role for RRM2 in gastric cancer cells and identify that the RRM2/AKT/NF-kappaB signaling pathway is essential for tumor invasiveness in gastric cancer cells
26921499 We suggest that MNNG-stimulated ATR/CHK1 signaling stabilizes E2F3 by S124 phosphorylation, and then E2F3 together with NFY co-transactivate RRM2 expression for DNA repair.
26718430 A significant association has been found between RRM2 rs6759180 (located in the 5'UTR, 10126436G>A) and the risk for developing non-small cell lung cancer.
26663950 High expression level of RRM2 might be negative prognostic factor for resected NSCLC patients.
26333382 Data show that ribonucleotide reductase M2 (RRM2) is associated with increased nuclear factor kappa B (NF-kappaB) activity.
26093293 Understanding the role of E2F1 in activating RRM2 transcription will help to explain the relationship between E2F1 and RRM2 in colorectal cancer
26026873 HBV exploits the Chk1-E2F1 axis of the DNA damage response pathway to induce R2 expression in a cell cycle-independent manner.
26001082 In non-small cell lung cancer, RRM2 expression was predictive of disease-specific survival in women, non-smokers and former smokers. Higher expression was associated with worse survival. This was not the case for men, and current or recently quit smokers.
25980818 The SCYL1- BP1 affects the cell cycle through increasing steady state levels of Cyclin F and RRM2 proteins, thus constituting a dual regulatory circuit.
25878246 R2 and p53R2 small subunits are subject to caspase-dependent degradation
More...

AA Sequence

MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDE      1 - 70
PLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGI     71 - 140
VNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWA    141 - 210
LRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHL    211 - 280
VHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM    281 - 350
ENISLEGKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF                                   351 - 389
//

Text Mined References (88)

PMID Year Title
27348973 2016 Overexpression of RRM2 in gastric cancer cell promotes their invasiveness via AKT/NF-?B signaling pathway.
26921499 2016 ATR-CHK1-E2F3 signaling transactivates human ribonucleotide reductase small subunit M2 for DNA repair induced by the chemical carcinogen MNNG.
26718430 2015 Investigation of some DNA repair genes association in non small cell lung cancer.
26663950 2015 Expression of Ribonucleotide Reductase Subunit-2 and Thymidylate Synthase Correlates with Poor Prognosis in Patients with Resected Stages I-III Non-Small Cell Lung Cancer.
26333382 2015 Targeting Ribonucleotide Reductase M2 and NF-?B Activation with Didox to Circumvent Tamoxifen Resistance in Breast Cancer.
26093293 2015 E2F1 promote the aggressiveness of human colorectal cancer by activating the ribonucleotide reductase small subunit M2.
26026873 2015 Hepatitis B virus induces RNR-R2 expression via DNA damage response activation.
26001082 2015 Ribonucleotide reductase subunit M2 predicts survival in subgroups of patients with non-small cell lung carcinoma: effects of gender and smoking status.
25980818 2016 SCYL1-BP1 affects cell cycle arrest in human hepatocellular carcinoma cells via Cyclin F and RRM2.
25878246 2015 Caspase-dependent Proteolysis of Human Ribonucleotide Reductase Small Subunits R2 and p53R2 during Apoptosis.
More...