Property Summary

NCBI Gene PubMed Count 32
PubMed Score 83.86
PubTator Score 6.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
pancreatic cancer 1.200 0.003
malignant mesothelioma 2.600 0.000
astrocytoma -1.700 0.000
posterior fossa group B ependymoma -3.000 0.000
glioblastoma -2.000 0.000
oligodendroglioma -1.700 0.000
osteosarcoma -1.076 0.004
group 4 medulloblastoma -2.700 0.000
atypical teratoid/rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.300 0.000
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -1.600 0.000
pancreatic carcinoma 1.200 0.003

Synonym

Accession P31321 Q8N422
Symbols PRKAR1

Gene

PDB

4DIN   4F9K  

Gene RIF (21)

PMID Text
25108559 No pathogenic PRKAR1B mutations were found in early onset familial dementia patients in a Dutch cohort.
24722252 This study demonistrated that PRKAR1B mutation associated with a new neurodegenerative disorder with unique pathology.
24189052 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
21651489 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
20588308 Observational study of gene-disease association. (HuGE Navigator)
20402410 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
20392842 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
20379146 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19895210 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
18836454 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
More...

AA Sequence

MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQK      1 - 70
SNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAH     71 - 140
LDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQGEVDVYVNGEWVTNISEGGSFGELALIYGTP    141 - 210
RAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGE    211 - 280
KIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKL    281 - 350
DRPRFERVLGPCSEILKRNIQRYNSFISLTV                                           351 - 381
//

Text Mined References (41)

PMID Year Title
25108559 2014 Mutation frequency of PRKAR1B and the major familial dementia genes in a Dutch early onset dementia cohort.
24722252 2014 PRKAR1B mutation associated with a new neurodegenerative disorder with unique pathology.
24605759 2014 Cyclic nucleotide mapping of hyperpolarization-activated cyclic nucleotide-gated (HCN) channels.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23115245 2012 A small novel A-kinase anchoring protein (AKAP) that localizes specifically protein kinase A-regulatory subunit I (PKA-RI) to the plasma membrane.
21812984 2011 The testis-specific C?2 subunit of PKA is kinetically indistinguishable from the common C?1 subunit of PKA.
20819953 2010 Regulation of cAMP-dependent protein kinases: the human protein kinase X (PrKX) reveals the role of the catalytic subunit alphaH-alphaI loop.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
More...