Property Summary

NCBI Gene PubMed Count 32
PubMed Score 86.22
PubTator Score 6.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.700 2.7e-04
astrocytic glioma -1.100 9.4e-03
Astrocytoma, Pilocytic -1.600 1.4e-06
atypical teratoid / rhabdoid tumor -1.600 1.0e-05
ependymoma -1.500 6.7e-03
glioblastoma -2.000 2.2e-10
group 3 medulloblastoma -1.600 1.6e-02
malignant mesothelioma 1.300 1.1e-06
medulloblastoma, large-cell -2.000 2.0e-05
oligodendroglioma -1.700 2.6e-19
osteosarcoma -1.076 4.0e-03
pancreatic cancer 1.200 3.4e-03
pancreatic carcinoma 1.200 3.4e-03
primitive neuroectodermal tumor -1.300 1.4e-04

Protein-protein Interaction (3)

Gene RIF (21)

AA Sequence

MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQK      1 - 70
SNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAH     71 - 140
LDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQGEVDVYVNGEWVTNISEGGSFGELALIYGTP    141 - 210
RAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGE    211 - 280
KIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKL    281 - 350
DRPRFERVLGPCSEILKRNIQRYNSFISLTV                                           351 - 381
//

Text Mined References (41)

PMID Year Title