Property Summary

NCBI Gene PubMed Count 39
Grant Count 47
R01 Count 30
Funding $6,552,756.5
PubMed Score 136.08
PubTator Score 67.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell -1.100 0.001

Gene RIF (23)

PMID Text
24001773 The occurrence of G-quadruplex structures at the HOX11 breakpoint region explain its fragility during the t(10;14) translocation.
22516263 The cortical thymic maturation arrest in T-lineage Acute lymphoblastic leukemias (ALLs) that overexpress TLX1 or TLX3 is due to binding of TLX1/TLX3 to ETS1.
22366949 these results place TLX1 and TLX3 at the top of an oncogenic transcriptional network controlling leukemia development, and identify RUNX1 as a tumor-suppressor gene in T-ALL
21326611 Suppression of TLX1 expression slowed the growth of TLX1 tumor cell lines. Suppression of TLX1 in vivo also transiently delayed leukemia progression.
20972433 Transgenic expression of human TLX1 in mice induces T cell acute lymphoblastic leukemia with frequent deletions and mutations in Bcl11b.
20618946 conclude that the TLX1/NOTCH/MYC network is a central determinant promoting the growth and survival of TLX1+ T-ALL cells. In addition, the TLX1/NOTCH/MYC transcriptional network coregulates genes involved in T cell development
19559479 co-operation between TLX1 and MEIS proteins may have a significant role in T-cell leukemogenesis.
19250647 TLX1 interacts with TLE1 via an Eh1-like motif.
18368072 Aberrant HOX11 expression is associated with thymic adult T-cell acute lymphoblastic leukemia
18283632 HOX11/TLX1 stem cells are uniquely and abundantly expressed throughout adulthood in the human spleen.
More...

AA Sequence

MEHLGPHHLHPGHAEPISFGIDQILNSPDQGGCMGPASRLQDGEYGLGCLVGGAYTYGGGGSAAATGAGG      1 - 70
AGAYGTGGPGGPGGPAGGGGACSMGPLTGSYNVNMALAGGPGPGGGGGSSGGAGALSAAGVIRVPAHRPL     71 - 140
AGAVAHPQPLATGLPTVPSVPAMPGVNNLTGLTFPWMESNRRYTKDRFTGHPYQNRTPPKKKKPRTSFTR    141 - 210
LQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQANRILLQLQQ    211 - 280
EAFQKSLAQPLPADPLCVHNSSLFALQNLQPWSDDSTKITSVTSVASACE                        281 - 330
//

Text Mined References (43)

PMID Year Title
24001773 2013 G-quadruplex structures formed at the HOX11 breakpoint region contribute to its fragility during t(10;14) translocation in T-cell leukemia.
22516263 2012 TLX homeodomain oncogenes mediate T cell maturation arrest in T-ALL via interaction with ETS1 and suppression of TCR? gene expression.
22366949 2012 Reverse engineering of TLX oncogenic transcriptional networks identifies RUNX1 as tumor suppressor in T-ALL.
21326611 2011 Transient responses to NOTCH and TLX1/HOX11 inhibition in T-cell acute lymphoblastic leukemia/lymphoma.
20972433 2010 The TLX1 oncogene drives aneuploidy in T cell transformation.
20618946 2010 TLX1 and NOTCH coregulate transcription in T cell acute lymphoblastic leukemia cells.
19862821 2010 Hematopoietic immortalizing function of the NKL-subclass homeobox gene TLX1.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19559479 2010 MEIS proteins as partners of the TLX1/HOX11 oncoprotein.
19250647 2009 Transcriptional activation by TLX1/HOX11 involves Gro/TLE corepressors.
More...