Property Summary

NCBI Gene PubMed Count 22
Grant Count 18
R01 Count 12
Funding $999,603.63
PubMed Score 35.20
PubTator Score 21.14

Knowledge Summary

Patent

No data available

Gene RIF (9)

PMID Text
25301728 POU2F1 activity regulates HOXD10 and HOXD11 gene expression in head and neck squamous cell carcinoma, promoting a proliferative and invasive phenotype.
20085705 In human embryonic stem cell (hESCs)differentiation, a 1.8kb region between HOXD11 and HOXD12 (D11.12) that is associated with PcG proteins was discovered, it shows alteration in nuclease sensitivity as hESCs differentiate.
19938081 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19540081 data show no significant difference in HOXD11, HOXD12 & HOXD13 genotype frequencies between the autism spectrum disorder & healthy controls, but one SNP in promoter region of HOXD11 was observed in only 4 patients with ASD
19540081 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19255789 Our findings do not support the hypothesis that mutations in the HOXD11 coding regions are involved in the pathogenesis of human non-syndromal congenital renal parenchymal malformations.
19255789 Observational study of gene-disease association. (HuGE Navigator)
11782354 The HOXD11 gene is fused to the NUP98 gene in acute myeloid leukemia with t(2;11)(q31;p15).

AA Sequence

MNDFDECGQSAASMYLPGCAYYVAPSDFASKPSFLSQPSSCQMTFPYSSNLAPHVQPVREVAFRDYGLER      1 - 70
AKWPYRGGGGGGSAGGGSSGGGPGGGGGGAGGYAPYYAAAAAAAAAAAAAEEAAMQRELLPPAGRRPDVL     71 - 140
FKAPEPVCAAPGPPHGPAGAASNFYSAVGRNGILPQGFDQFYEAAPGPPFAGPQPPPPPAPPQPEGAADK    141 - 210
GDPRTGAGGGGGSPCTKATPGSEPKGAAEGSGGDGEGPPGEAGAEKSSSAVAPQRSRKKRCPYTKYQIRE    211 - 280
LEREFFFNVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKLNRDRLQYFTGNPLF                281 - 338
//

Text Mined References (23)

PMID Year Title
25301728 2014 POU2F1 activity regulates HOXD10 and HOXD11 promoting a proliferative and invasive phenotype in head and neck cancer.
20085705 2010 A region of the human HOXD cluster that confers polycomb-group responsiveness.
19938081 2009 Altered transmission of HOX and apoptotic SNPs identify a potential common pathway for clubfoot.
19540081 2010 Study of HOXD genes in autism particularly regarding the ratio of second to fourth digit length.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19255789 2009 Absence of mutations in the HOXA11 and HOXD11 genes in children with congenital renal malformations.
17236141 2007 Mutations in HOXD13 underlie syndactyly type V and a novel brachydactyly-syndactyly syndrome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12357469 2002 Limb malformations and the human HOX genes.
More...