Property Summary

NCBI Gene PubMed Count 34
PubMed Score 41.74
PubTator Score 567.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
inflammatory breast cancer 1.100 2.5e-02
invasive ductal carcinoma 1.400 2.1e-03
malignant mesothelioma 2.400 3.8e-08

Gene RIF (15)

AA Sequence

MTTSLLLHPRWPESLMYVYEDSAAESGIGGGGGGGGGGTGGAGGGCSGASPGKAPSMDGLGSSCPASHCR      1 - 70
DLLPHPVLGRPPAPLGAPQGAVYTDIPAPEAARQCAPPPAPPTSSSATLGYGYPFGGSYYGCRLSHNVNL     71 - 140
QQKPCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFASSYQAMPGYLDVSVVPGISGHPEPRHDALIP    141 - 210
VEGYQHWALSNGWDSQVYCSKEQSQSAHLWKSPFPDVVPLQPEVSSYRRGRKKRVPYTKVQLKELEKEYA    211 - 280
ASKFITKEKRRRISATTNLSERQVTIWFQNRRVKEKKVVSKSKAPHLHST                        281 - 330
//

Text Mined References (35)

PMID Year Title