Property Summary

NCBI Gene PubMed Count 31
Grant Count 21
R01 Count 13
Funding $2,365,893.04
PubMed Score 37.56
PubTator Score 567.84

Knowledge Summary

Patent

No data available

Gene RIF (12)

PMID Text
25691658 YAP regulates the expression of HOXA1 and HOXC13 in human keratinocytes.
24085196 In conclusion, our data show a deregulation of the HOXC13 marker in welldifferentiated and dedifferentiated LPSs, possibly related to 12q13-15 chromosomal amplification.
23461661 Results show that duplication and nonsense mutation lead to loss of function in this gene and the role it plays in hair and nail development
23315978 Identification of a homozygous mutation in the HOXC13 gene in a Syrian family with autosomal-recessive pure hair and nail ectodermal dysplasia.
23063621 loss-of-function mutations in HOXC13 cause autosomal-recessive PHNED and further highlight the importance of HOXC13 in hair and nail development.
22583695 results show the strong and progressive HOX C13 overexpression in metastatic melanoma tissues and cytological samples compared to nevi and primary melanoma tissues and cells.
20935629 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20661663 knockdown of BMI-1 expression can induce cell-cycle arrest and up-regulate p16INK4a, HOXA9 and HOXC13 in HeLa cells
19665070 To our knowledge, this is the first case of t(11;12)(p15;q13) in de novo AML-M4 in association with FLT3 ITD mutation. Coexistence of NUP98-HOXC13 fusion and FLT3 ITD mutation is likely relevant in the process of leukemogenesis
19182517 Results show that HOXC13 is a member of human replicative complexes.
More...

AA Sequence

MTTSLLLHPRWPESLMYVYEDSAAESGIGGGGGGGGGGTGGAGGGCSGASPGKAPSMDGLGSSCPASHCR      1 - 70
DLLPHPVLGRPPAPLGAPQGAVYTDIPAPEAARQCAPPPAPPTSSSATLGYGYPFGGSYYGCRLSHNVNL     71 - 140
QQKPCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFASSYQAMPGYLDVSVVPGISGHPEPRHDALIP    141 - 210
VEGYQHWALSNGWDSQVYCSKEQSQSAHLWKSPFPDVVPLQPEVSSYRRGRKKRVPYTKVQLKELEKEYA    211 - 280
ASKFITKEKRRRISATTNLSERQVTIWFQNRRVKEKKVVSKSKAPHLHST                        281 - 330
//

Text Mined References (31)

PMID Year Title
25691658 2015 YAP regulates the expression of Hoxa1 and Hoxc13 in mouse and human oral and skin epithelial tissues.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25343990 2015 Genome-wide association study of selenium concentrations.
24085196 2013 Hyperexpression of HOXC13, located in the 12q13 chromosomal region, in well?differentiated and dedifferentiated human liposarcomas.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23461661 2013 Novel mutations in the gene HOXC13 underlying pure hair and nail ectodermal dysplasia in consanguineous families.
23315978 2013 A homozygous frameshift mutation in the HOXC13 gene underlies pure hair and nail ectodermal dysplasia in a Syrian family.
23063621 2012 Loss-of-function mutations in HOXC13 cause pure hair and nail ectodermal dysplasia.
22583695 2012 Increased HOX C13 expression in metastatic melanoma progression.
20935629 2010 Meta-analysis identifies 13 new loci associated with waist-hip ratio and reveals sexual dimorphism in the genetic basis of fat distribution.
More...