Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.99
PubTator Score 3.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Clubfoot 39 3.669 1.8

Expression

Gene RIF (1)

AA Sequence

MGEHNLLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLSWPSAEPCNGYPQPYLG      1 - 70
SPVSLNPPFGRTCELARVEDGKGYYREPCAEGGGGGLKREERGRDPGAGPGAALLPLEPSGPPALGFKYD     71 - 140
YAAGGGGGDGGGGAGPPHDPPSCQSLESDSSSSLLNEGNKGAGAGDPGSLVSPLNPGGGLSASGAPWYPI    141 - 210
NSRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRLLLREQALS    211 - 280
FF                                                                        281 - 282
//

Text Mined References (6)

PMID Year Title