Property Summary

NCBI Gene PubMed Count 5
Grant Count 4
R01 Count 4
Funding $358,453.32
PubMed Score 3.53
PubTator Score 3.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Clubfoot 35 3.766 1.9

AA Sequence

MGEHNLLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLSWPSAEPCNGYPQPYLG      1 - 70
SPVSLNPPFGRTCELARVEDGKGYYREPCAEGGGGGLKREERGRDPGAGPGAALLPLEPSGPPALGFKYD     71 - 140
YAAGGGGGDGGGGAGPPHDPPSCQSLESDSSSSLLNEGNKGAGAGDPGSLVSPLNPGGGLSASGAPWYPI    141 - 210
NSRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRLLLREQALS    211 - 280
FF                                                                        281 - 282
//

Text Mined References (5)

PMID Year Title
11857506 2002 Complete mutation analysis panel of the 39 human HOX genes.
9357979 1997 Distinct patterns of all-trans retinoic acid dependent expression of HOXB and HOXC homeogenes in human embryonal and small-cell lung carcinoma cell lines.
2574852 1989 The human HOX gene family.
1973146 1990 Nomenclature for human homeobox genes.
1358459 1992 Vertebrate homeobox gene nomenclature.