Property Summary

NCBI Gene PubMed Count 25
Grant Count 9
R01 Count 9
Funding $784,426.67
PubMed Score 23.90
PubTator Score 5.81

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
26647900 HOXC9 and HOXC10 may play an important role in the development of obesity, adverse fat distribution, and subsequent alterations in whole-body metabolism and adipose tissue function.
25444900 Results provide a set of the essential genes in the miR-193a-3p/HOXC9/DNA damage response/oxidative stress pathway axis as the diagnostic targets for the guided anti-bladder cancer chemotherapy.
24274069 HOXC9 coordinates diverse cellular processes associated with differentiation by directly activating and repressing the transcription of distinct sets of genes.
23579273 HoxC9 activates the intrinsic pathway of apoptosis and is associated with spontaneous regression in neuroblastoma.
22106857 We did not find any potential pathological mutations in the Hoxc9 gene among Chinese patients with congenital heart disease.
21507931 HOXC9 links cell-cycle exit and neuronal differentiation and is a prognostic marker in neuroblastoma.
21493894 The data identify HOXC9 as an endothelial cell active transcriptional repressor promoting the resting, antiangiogenic endothelial cell phenotype in an interleukin 8-dependent manner
19506903 Methylated state of this set of genes may be more specific to the late rather than the early stage of NSCLC.
17588684 Up-regulation of HOXC9 was detected in a set of 54 astrocytomas of different grades and significantly associated with malignancy.

AA Sequence

MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDFPSCSFAPKPAVFSTSWAPVP      1 - 70
SQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAYPGRRADCGPGEGRSYPD     71 - 140
YMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYTKYQTLELEKE    141 - 210
FLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQS                        211 - 260
//

Text Mined References (28)

PMID Year Title
26647900 2016 Fat depot-specific expression of HOXC9 and HOXC10 may contribute to adverse fat distribution and related metabolic traits.
25444900 2015 MiR-193a-3p promotes the multi-chemoresistance of bladder cancer by targeting the HOXC9 gene.
25416956 2014 A proteome-scale map of the human interactome network.
24274069 2013 HOXC9 directly regulates distinct sets of genes to coordinate diverse cellular processes during neuronal differentiation.
23579273 2013 Hox-C9 activates the intrinsic pathway of apoptosis and is associated with spontaneous regression in neuroblastoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22615398 2012 Structural basis for homeodomain recognition by the cell-cycle regulator Geminin.
22106857 2012 Homeobox C9 is not potentially related to congenital heart disease in Chinese patients.
21507931 2011 HOXC9 links cell-cycle exit and neuronal differentiation and is a prognostic marker in neuroblastoma.
21493894 2011 The transcription factor HOXC9 regulates endothelial cell quiescence and vascular morphogenesis in zebrafish via inhibition of interleukin 8.
More...