Property Summary

NCBI Gene PubMed Count 27
PubMed Score 26.45
PubTator Score 5.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (10)

AA Sequence

MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDFPSCSFAPKPAVFSTSWAPVP      1 - 70
SQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAYPGRRADCGPGEGRSYPD     71 - 140
YMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYTKYQTLELEKE    141 - 210
FLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQS                        211 - 260
//

Text Mined References (30)

PMID Year Title