Property Summary

NCBI Gene PubMed Count 34
PubMed Score 74.04
PubTator Score 522.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 4.6e-04
glioblastoma 1.100 2.8e-03
malignant mesothelioma -4.200 4.2e-07
medulloblastoma, large-cell 1.400 2.1e-05
osteosarcoma 1.185 1.9e-05

Gene RIF (14)

AA Sequence

MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNS      1 - 70
GYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFP     71 - 140
WMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNK    141 - 210
DKLPGARDEEKVEEEGNEEEEKEEEEKEENKD                                          211 - 242
//

Text Mined References (35)

PMID Year Title