Property Summary

NCBI Gene PubMed Count 31
Grant Count 37
R01 Count 25
Funding $3,548,496.85
PubMed Score 72.02
PubTator Score 522.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -4.200 0.000
osteosarcoma 1.185 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.100 0.003
medulloblastoma, large-cell 1.400 0.000

Gene RIF (11)

PMID Text
26123838 Upregulated HOXC8 expression was associated with oxaliplatin resistance in hepatocellular carcinoma.
26090721 embigin is regulated by HOXC8 and its loss plays an important role in the progression of breast tumors
25745994 Ectopic expression of HoxC8 inhibits nasopharyngeal carcinoma cell growth in vitro and in vivo, modulates glycolysis and regulates the expression of tricarboxylic acid (TCA) cycle-related genes.
24817935 miR-196a was over-expressed in cervical cancer cells, while an absence of HOXC8 expression was observed.
24810778 HOXC8 promotes breast tumorigenesis by transcriptionally facilitating cadherin-11 expression.
24525058 HOXC8 can be used as a prognostic marker in esophageal squamous cell carcinoma
21712827 HOXC8 expression is inversely related to pancreatic ductal adenocarcinoma progression and metastasis.
21047772 a complex role for HOXC8 in prostate cancer, promoting invasiveness while inhibiting AR-mediated gene induction at androgen response element-regulated genes associated with differentiated function of the prostate
20736365 Ratio of microRNA to HOXC8 mRNA may be an indicator of the metastatic capability of breast tumors.
16637071 Androgen-independent cell line DU145 cells lack PLZF gene expression, resulting in the upregulation of Pbx1 and HoxC8 expression. The Pbx1-HoxC8 heterocomplex may lead to androgen-independent growth in prostate cancer.
More...

AA Sequence

MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNS      1 - 70
GYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFP     71 - 140
WMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNK    141 - 210
DKLPGARDEEKVEEEGNEEEEKEEEEKEENKD                                          211 - 242
//

Text Mined References (32)

PMID Year Title
26123838 2015 Upregulated HOXC8 Expression Is Associated with Poor Prognosis and Oxaliplatin Resistance in Hepatocellular Carcinoma.
26090721 2015 Embigin, regulated by HOXC8, plays a suppressive role in breast tumorigenesis.
25745994 2015 Repression of Hox genes by LMP1 in nasopharyngeal carcinoma and modulation of glycolytic pathway genes by HoxC8.
24817935 2014 Heterogeneity of microRNAs expression in cervical cancer cells: over-expression of miR-196a.
24810778 2014 HOXC8 promotes breast tumorigenesis by transcriptionally facilitating cadherin-11 expression.
24525058 2014 The survival predictive significance of HOXC6 and HOXC8 in esophageal squamous cell carcinoma.
21712827 2011 Expression of HOXC8 is inversely related to the progression and metastasis of pancreatic ductal adenocarcinoma.
21047772 2010 HOXC8 inhibits androgen receptor signaling in human prostate cancer cells by inhibiting SRC-3 recruitment to direct androgen target genes.
20736365 2010 Ratio of miR-196s to HOXC8 messenger RNA correlates with breast cancer cell migration and metastasis.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
More...