Property Summary

NCBI Gene PubMed Count 47
Grant Count 27
R01 Count 23
Funding $3,898,971.46
PubMed Score 113.68
PubTator Score 74.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
urothelial carcinoma -2.500 0.018
adrenocortical carcinoma 2.175 0.000
interstitial cystitis -2.200 0.000
ovarian cancer -1.200 0.000

Gene RIF (31)

PMID Text
26695677 Transfection of HOXA13 in HKCs could inhibit the degree of EMT induced by albumin-overload, possibly by increasing BMP-7 expression.
26590955 Atypical hand-foot-genital syndrome and developmental delay due to de novo mutations in HOXA13 and NRXN1
26485220 This pregnancy-maintaining regionalization of myometrial function may be mediated by HoxA13
26356815 HOXA13 promotes glioma progression in part via Wnt- and TGF-beta-induced epithelial-mesenchymal transition
26043692 study demonstrates that aberrant reduction of HOTTIP and HOXA13, which have a bidirectional regulatory loop, may play an important role in the pathogenesis of HSCR
25889214 HOTTIP/HOXA13 axis is a potential therapeutic target and molecular biomarker for pancreatic ductal adenocarcinoma.
25472883 HIV-1 Tat specifically associates with HOXA13 promoter to upregulate HOXA13 expression in T cells
25341685 serum HOXA13 may serve as a biomarker for early hepatocellular carcinoma diagnosing and predicting outcome.
24626613 the present study demonstrated that ANXA2 and SOD2 are potential target genes of HOXA13 and their coexpression predicts the poor prognosis of Esophageal squamous cell carcinoma patients.
24114970 Our study highlights the key role of HOTTIP and HOXA13 in hepatocellular carcinoma development.
More...

AA Sequence

MTASVLLHPRWIEPTVMFLYDNGGGLVADELNKNMEGAAAAAAAAAAAAAAGAGGGGFPHPAAAAAGGNF      1 - 70
SVAAAAAAAAAAAANQCRNLMAHPAPLAPGAASAYSSAPGEAPPSAAAAAAAAAAAAAAAAAASSSGGPG     71 - 140
PAGPAGAEAAKQCSPCSAAAQSSSGPAALPYGYFGSGYYPCARMGPHPNAIKSCAQPASAAAAAAFADKY    141 - 210
MDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWA    211 - 280
LPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSYRRGRKKRVPYTKVQLKELEREYATNKFITKD    281 - 350
KRRRISATTNLSERQVTIWFQNRRVKEKKVINKLKTTS                                    351 - 388
//

Text Mined References (49)

PMID Year Title
26695677 2015 [Effect of Homeobox A13 transfection on epithelial-mesenchymal transition and bone morphogenetic protein-7 expression in kidney tubular epithelial cells].
26590955 2016 Dual genetic diagnoses: Atypical hand-foot-genital syndrome and developmental delay due to de novo mutations in HOXA13 and NRXN1.
26485220 2015 HoxA13 Regulates Phenotype Regionalization of Human Pregnant Myometrium.
26356815 2015 HOXA13 is a potential GBM diagnostic marker and promotes glioma invasion by activating the Wnt and TGF-? pathways.
26043692 2015 Long none coding RNA HOTTIP/HOXA13 act as synergistic role by decreasing cell migration and proliferation in Hirschsprung disease.
25889214 2015 The long non-coding RNA HOTTIP promotes progression and gemcitabine resistance by regulating HOXA13 in pancreatic cancer.
25341685 2014 Overexpression of HOXA13 as a potential marker for diagnosis and poor prognosis of hepatocellular carcinoma.
24934387 2014 Severe manifestations of hand-foot-genital syndrome associated with a novel HOXA13 mutation.
24626613 2014 Coexpression of ANXA2, SOD2 and HOXA13 predicts poor prognosis of esophageal squamous cell carcinoma.
24114970 2014 Long noncoding RNA HOTTIP/HOXA13 expression is associated with disease progression and predicts outcome in hepatocellular carcinoma patients.
More...