Property Summary

NCBI Gene PubMed Count 49
Grant Count 50
R01 Count 30
Funding $3,350,086.02
PubMed Score 81.18
PubTator Score 64.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -2.700 0.000
osteosarcoma 1.124 0.045
adrenocortical carcinoma 1.089 0.009
interstitial cystitis -1.500 0.001
psoriasis -1.100 0.000

Gene RIF (30)

PMID Text
26552702 Regulated HOXA10 and HOXA11 expression is necessary for endometrial receptivity; decreased HOXA10 or HOXA11 expression leads to decreased implantation rates. Alternation of HOXA10 and HOXA11 expression has been identified as a mechanism of the decreased implantation associated with endometriosis, polycystic ovarian syndrome, leiomyoma, polyps, adenomyosis, and hydrosalpinx.
26056923 Laparoscopic endometrioma resection increases peri-implantation endometrial HOXA-11 mRNA expression.
25630974 The overexpression of miR-30d or 181a suppressed HOXA11 mRNA.
25590359 Epigenetic silencing of HOXA11 promotes gastric cancer proliferation, migration and invasion through activation of Wnt signaling.
24745830 Mutations in the coding region of HOXA11 are not common in Chinese women with Mullerian duct anomalies.
24306662 Low HOXA11 expression is associated with hepatocellular carcinoma.
24259349 Study suggests that HOXA11 hypermethylation may contribute to the progression of NSCLC by promoting cell proliferation or migration.
23979130 Lower expression of HOXA11 is associated with endometriosis-associated infertility.
23624749 Promoter methylation of HOXA11 is associated with glioblastoma.
22251480 Data show that up-regulation of the HOXA7, HOXA9, HOXA11, and PBX3 resulting from the down-regulation of miR-181 family members probably contribute to the poor prognosis of patients with nonfavorable cytogenetically abnormal AML (CA-AML).
More...

AA Sequence

MDFDERGPCSSNMYLPSCTYYVSGPDFSSLPSFLPQTPSSRPMTYSYSSNLPQVQPVREVTFREYAIEPA      1 - 70
TKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAF     71 - 140
DQFFETAYGTPENLASSDYPGDKSAEKGPPAATATSAAAAAAATGAPATSSSDSGGGGGCRETAAAAEEK    141 - 210
ERRRRPESSSSPESSSGHTEDKAGGSSGQRTRKKRCPYTKYQIRELEREFFFSVYINKEKRLQLSRMLNL    211 - 280
TDRQVKIWFQNRRMKEKKINRDRLQYYSANPLL                                         281 - 313
//

Text Mined References (49)

PMID Year Title
26552702 2015 The Role of Hox Genes in Female Reproductive Tract Development, Adult Function, and Fertility.
26056923 2015 Laparoscopic endometrioma resection increases peri-implantation endometrial HOXA-10 and HOXA-11 mRNA expression.
25630974 2015 MicroRNA-30d and microRNA-181a regulate HOXA11 expression in the uterosacral ligaments and are overexpressed in pelvic organ prolapse.
25590359 2015 Epigenetic changes and functional study of HOXA11 in human gastric cancer.
24745830 2014 Mutations in HOXA11 are not responsible for Müllerian duct anomalies in Chinese patients.
24306662 2014 DNA methylation profiling identifies EYA4 gene as a prognostic molecular marker in hepatocellular carcinoma.
24259349 2013 HOXA11 hypermethylation is associated with progression of non-small cell lung cancer.
23979130 2013 HOXA-11 mediated dysregulation of matrix remodeling during implantation window in women with endometriosis.
23624749 2013 Promoter methylation of AREG, HOXA11, hMLH1, NDRG2, NPTX2 and Tes genes in glioblastoma.
22251480 2012 Up-regulation of a HOXA-PBX3 homeobox-gene signature following down-regulation of miR-181 is associated with adverse prognosis in patients with cytogenetically abnormal AML.
More...