Property Summary

NCBI Gene PubMed Count 53
PubMed Score 87.23
PubTator Score 64.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
adrenocortical carcinoma 1.089 9.4e-03
interstitial cystitis -1.400 3.5e-03
malignant mesothelioma -1.600 1.2e-06
osteosarcoma 1.124 4.5e-02
psoriasis -1.100 2.4e-30

Gene RIF (34)

AA Sequence

MDFDERGPCSSNMYLPSCTYYVSGPDFSSLPSFLPQTPSSRPMTYSYSSNLPQVQPVREVTFREYAIEPA      1 - 70
TKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAF     71 - 140
DQFFETAYGTPENLASSDYPGDKSAEKGPPAATATSAAAAAAATGAPATSSSDSGGGGGCRETAAAAEEK    141 - 210
ERRRRPESSSSPESSSGHTEDKAGGSSGQRTRKKRCPYTKYQIRELEREFFFSVYINKEKRLQLSRMLNL    211 - 280
TDRQVKIWFQNRRMKEKKINRDRLQYYSANPLL                                         281 - 313
//

Text Mined References (53)

PMID Year Title