Property Summary

NCBI Gene PubMed Count 125
PubMed Score 253.18
PubTator Score 178.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 2.04648558489803E-18
malignant mesothelioma 3163 5.20136742029178E-10
Breast cancer 3099 9.23333049713221E-10
ovarian cancer 8492 1.66885396886695E-5
interstitial cystitis 2299 6.30786772071887E-5
sonic hedgehog group medulloblastoma 1482 1.1772139950798E-4
psoriasis 6685 5.80693822655401E-4
cutaneous lupus erythematosus 1056 0.00287402485875266
urothelial carcinoma 318 0.00335548781986392
invasive ductal carcinoma 2950 0.00438974166754348
fascioscapulohumeral muscular dystrophy 100 0.0100123419960613
adult high grade glioma 2148 0.0187754473520111
glioblastoma 5572 0.0224910594074216
Atopic dermatitis 944 0.0311776464484623
colon cancer 1475 0.0391849311316153
Disease Target Count Z-score Confidence
Cancer 2346 4.819 2.4

Expression

  Differential Expression (15)

Disease log2 FC p
urothelial carcinoma -4.200 0.003
malignant mesothelioma -6.300 0.000
cutaneous lupus erythematosus -3.900 0.003
psoriasis 1.600 0.001
glioblastoma 1.700 0.022
sonic hedgehog group medulloblastoma 5.300 0.000
fascioscapulohumeral muscular dystrophy 1.021 0.010
Atopic dermatitis -1.800 0.031
colon cancer 1.800 0.039
breast carcinoma -1.500 0.000
interstitial cystitis -1.800 0.000
adult high grade glioma 1.500 0.019
Breast cancer -3.500 0.000
invasive ductal carcinoma -2.800 0.004
ovarian cancer -3.100 0.000

Synonym

Accession P31269 O43369 O43429 Q99820
Symbols HOX1
ABD-B
HOX1G
HOX1.7

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (100)

PMID Text
26740045 The results indicate that highly selective targeting of Nup98-fusion proteins to Hox cluster regions via prebound Crm1 induces the formation of higher order chromatin structures that causes aberrant Hox gene regulation.
26679037 Study found that hypermethylation of CpG probes in the promoter regions of HOXA9 and PCDH10 was associated with mature B-cell neoplasms.
26332997 Concurrent ISL1/HOXA9 methylation in HG-NMIBC reliably predicted tumour recurrence and progression within one year, and was associated with disease-specific mortality
26130510 Pbx3 contributes to Hoxa9 leukemogenesis through stabilization of the Meis1 protein.
26059450 HOXA9 and MEIS1 overexpression are inversely correlated with relapse and overall survival, so the genes could become useful predictive markers of the clinical course of pediatric acute leukemias.
26028034 With continued advances in understanding HOXA9-mediated transformation, there is a wealth of opportunity for developing novel therapeutics that would be applicable for greater than 50% of AML with overexpression of HOXA9
25987065 Increased expression of HOXA9 is associated with acute myeloid leukemia.
25762636 Data establish HOXA9 as a driver of glioma initiation, aggressiveness and resistance to therapy.
25246116 variants in the HOXA7 and HOXA9 genes are not common in Chinese women with Mullerian duct abnormalities
25185710 Different gain-of-function and loss-of-function studies reveal that HOXA9 enhances hematopoietic differentiation of embryonic stem cells by specifically promoting the commitment of hemogenic precursors into primitive and total CD45(+) blood cells.
More...

AA Sequence

MATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAEHPDFSPCSFQSKATVFGASWNPV      1 - 70
HAAGANAVPAAVYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSAR     71 - 140
RGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAANWLHARSTRKKR    141 - 210
CPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE            211 - 272
//

Text Mined References (125)

PMID Year Title
26740045 2016 Chromatin-prebound Crm1 recruits Nup98-HoxA9 fusion to induce aberrant expression of Hox cluster genes.
26679037 2016 Global measures of peripheral blood-derived DNA methylation as a risk factor in the development of mature B-cell neoplasms.
26332997 2015 Methylation of HOXA9 and ISL1 Predicts Patient Outcome in High-Grade Non-Invasive Bladder Cancer.
26130510 2015 Dangerous liaisons: cooperation between Pbx3, Meis1 and Hoxa9 in leukemia.
26059450 2015 HOXA9 and MEIS1 gene overexpression in the diagnosis of childhood acute leukemias: Significant correlation with relapse and overall survival.
26028034 2016 Role of HOXA9 in leukemia: dysregulation, cofactors and essential targets.
25987065 2015 Aberrant Expression of HOXA5 and HOXA9 in AML.
25762636 2015 A transcriptomic signature mediated by HOXA9 promotes human glioblastoma initiation, aggressiveness and resistance to temozolomide.
25246116 2014 Mutation screening of HOXA7 and HOXA9 genes in Chinese women with Müllerian duct abnormalities.
25185710 2014 HOXA9 promotes hematopoietic commitment of human embryonic stem cells.
More...