Property Summary

NCBI Gene PubMed Count 141
PubMed Score 265.24
PubTator Score 178.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.400 4.8e-03
Atopic dermatitis -1.800 3.1e-02
Breast cancer -2.500 3.8e-09
breast carcinoma -1.300 5.6e-06
colon cancer 1.800 3.9e-02
cutaneous lupus erythematosus -3.300 7.4e-05
fascioscapulohumeral muscular dystrophy 1.021 1.0e-02
glioblastoma 1.100 2.8e-02
group 3 medulloblastoma 2.600 5.1e-03
interstitial cystitis -1.600 8.2e-04
invasive ductal carcinoma -1.800 3.7e-04
malignant mesothelioma -5.900 3.9e-10
ovarian cancer -1.100 9.1e-03
psoriasis 1.600 5.8e-04
urothelial carcinoma -3.400 8.6e-04

Gene RIF (116)

AA Sequence

MATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAEHPDFSPCSFQSKATVFGASWNPV      1 - 70
HAAGANAVPAAVYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSAR     71 - 140
RGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAANWLHARSTRKKR    141 - 210
CPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE            211 - 272
//

Text Mined References (141)

PMID Year Title