Property Summary

NCBI Gene PubMed Count 39
Grant Count 34
R01 Count 21
Funding $1,835,021.18
PubMed Score 217.93
PubTator Score 71.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
psoriasis 1.400 0.000
glioblastoma 1.500 0.010
sonic hedgehog group medulloblastoma 4.200 0.000
cystic fibrosis -1.257 0.000
medulloblastoma, large-cell 1.200 0.017
adult high grade glioma 1.800 0.006
Breast cancer -2.800 0.000
ductal carcinoma in situ -1.600 0.000
invasive ductal carcinoma -2.200 0.000
ovarian cancer -1.400 0.000

 GO Component (1)

Gene RIF (18)

PMID Text
26828989 HOXA7 might be a new gene candidate that influences the maturation of acute myeloid leukemia.
25501982 HOXA7 promotes cell proliferation, and these changes were mediated by cyclin E1/CDK2
25246116 variants in the HOXA7 and HOXA9 genes are not common in Chinese women with Mullerian duct abnormalities
24099775 This finding contributes to our understanding of the role HOXA7 plays in regulating the proliferation of ER-positive cancer cells.
23660297 Hoxa7, Hoxa9 and Hox cofactor Meis1 were identified as AP-2alpha target genes, which are involved in myeloid leukemogenesis.
22251480 Data show that up-regulation of the HOXA7, HOXA9, HOXA11, and PBX3 resulting from the down-regulation of miR-181 family members probably contribute to the poor prognosis of patients with nonfavorable cytogenetically abnormal AML (CA-AML).
22085718 Taken together, these results support the notion that down-regulation of PCGF2 is sufficient to induce granulocytic differentiation of HL-60 cells via de-repression of HOXA7 gene expression.
21518888 Several targets of MLL fusions, MEIS1, HOXA7, HOXA9, and HOXA10 are functionally related and have been implicated in leukemias. Each of the four genes was knocked down separately in the precursor B-cell leukemic line RS4;11 expressing MLL-AF4.
21323949 HOXA7, PIXT1 and PRRX1 homeobox genes have different patterns of expression in oral squamous cell carcinomas depending on its histological features.
20634891 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSPLYQSPFASGY      1 - 70
GLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGAAEANFRIYPWMRSSGPDRKRGRQTYTRY     71 - 140
QTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKDEGPTAAAAPEGAVPSAAAT    141 - 210
AAADKADEEDDDEEEEDEEE                                                      211 - 230
//

Text Mined References (39)

PMID Year Title
26828989 2016 All-trans retinoic acid inhibits HOXA7 expression in leukemia cell NB4.
25501982 2015 HOXA7 stimulates human hepatocellular carcinoma proliferation through cyclin E1/CDK2.
25246116 2014 Mutation screening of HOXA7 and HOXA9 genes in Chinese women with Müllerian duct abnormalities.
24099775 2013 Homeobox A7 stimulates breast cancer cell proliferation by up-regulating estrogen receptor-alpha.
23660297 2013 Transcription factor AP-2? regulates acute myeloid leukemia cell proliferation by influencing Hoxa gene expression.
22251480 2012 Up-regulation of a HOXA-PBX3 homeobox-gene signature following down-regulation of miR-181 is associated with adverse prognosis in patients with cytogenetically abnormal AML.
22085718 2011 Inhibition of PCGF2 enhances granulocytic differentiation of acute promyelocytic leukemia cell line HL-60 via induction of HOXA7.
21518888 2011 Down-regulation of homeobox genes MEIS1 and HOXA in MLL-rearranged acute leukemia impairs engraftment and reduces proliferation.
21323949 2011 In situ hybridization detection of homeobox genes reveals distinct expression patterns in oral squamous cell carcinomas.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
More...