Property Summary

NCBI Gene PubMed Count 40
PubMed Score 219.53
PubTator Score 71.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.800 5.9e-03
Breast cancer -1.400 2.2e-06
cystic fibrosis -1.257 1.1e-04
ductal carcinoma in situ -1.100 1.8e-04
glioblastoma 1.500 9.6e-03
group 3 medulloblastoma 1.600 4.5e-03
invasive ductal carcinoma -1.300 8.4e-05
malignant mesothelioma -1.500 2.8e-06
medulloblastoma, large-cell 1.200 1.7e-02
ovarian cancer -1.400 9.7e-05
psoriasis 1.400 3.8e-04

Gene RIF (19)

AA Sequence

MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSPLYQSPFASGY      1 - 70
GLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGAAEANFRIYPWMRSSGPDRKRGRQTYTRY     71 - 140
QTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKDEGPTAAAAPEGAVPSAAAT    141 - 210
AAADKADEEDDDEEEEDEEE                                                      211 - 230
//

Text Mined References (40)

PMID Year Title