Tbio | Homeobox protein Hox-A10 |
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Binds to the DNA sequence 5'-AA[AT]TTTTATTAC-3'.
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor that may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function in fertility, embryo viability, and regulation of hematopoietic lineage commitment. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the downstream homeobox A9 (HOXA9) gene. [provided by RefSeq, Mar 2011]
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor that may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function in fertility, embryo viability, and regulation of hematopoietic lineage commitment. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the downstream homeobox A9 (HOXA9) gene. [provided by RefSeq, Mar 2011]
Comments
Disease | Target Count |
---|---|
Adenocarcinoma | 115 |
Endometrial Neoplasms | 50 |
Female Urogenital Diseases | 18 |
Disease | Target Count | P-value |
---|---|---|
non-small cell lung cancer | 2798 | 2.83243589438035E-11 |
acute quadriplegic myopathy | 1157 | 3.50057160866987E-5 |
psoriasis | 6685 | 7.10108666950747E-5 |
pancreatic cancer | 2300 | 1.98723213895044E-4 |
adult high grade glioma | 2148 | 2.31913779721967E-4 |
Atopic dermatitis | 944 | 3.15471883417777E-4 |
nasopharyngeal carcinoma | 1056 | 5.26048734947093E-4 |
glioblastoma | 5572 | 5.68424585817007E-4 |
interstitial cystitis | 2299 | 9.26783475487815E-4 |
invasive ductal carcinoma | 2950 | 0.00167840797863495 |
sonic hedgehog group medulloblastoma | 1482 | 0.00169000654235656 |
cutaneous lupus erythematosus | 1056 | 0.00907785008608388 |
esophageal adenocarcinoma | 737 | 0.0190553920760902 |
ductal carcinoma in situ | 1745 | 0.0252005380164751 |
intraductal papillary-mucinous carcinoma (IPMC) | 2988 | 0.0345480650596566 |
intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 0.0457783060995613 |
Disease | log2 FC | p |
---|---|---|
esophageal adenocarcinoma | 1.700 | 0.019 |
psoriasis | -1.400 | 0.000 |
cutaneous lupus erythematosus | -2.800 | 0.009 |
glioblastoma | 2.000 | 0.001 |
sonic hedgehog group medulloblastoma | 3.300 | 0.002 |
acute quadriplegic myopathy | -1.200 | 0.000 |
Atopic dermatitis | -1.500 | 0.000 |
non-small cell lung cancer | 1.688 | 0.000 |
intraductal papillary-mucinous carcinoma... | 1.800 | 0.035 |
intraductal papillary-mucinous neoplasm ... | 1.200 | 0.046 |
pancreatic cancer | 1.700 | 0.000 |
interstitial cystitis | -1.400 | 0.001 |
adult high grade glioma | 2.100 | 0.000 |
nasopharyngeal carcinoma | 1.300 | 0.001 |
ductal carcinoma in situ | -1.500 | 0.025 |
invasive ductal carcinoma | -2.700 | 0.002 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Mouse | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26552702 | Regulated HOXA10 and HOXA11 expression is necessary for endometrial receptivity; decreased HOXA10 or HOXA11 expression leads to decreased implantation rates. Alternation of HOXA10 and HOXA11 expression has been identified as a mechanism of the decreased implantation associated with endometriosis, polycystic ovarian syndrome, leiomyoma, polyps, adenomyosis, and hydrosalpinx. |
26552644 | The combinatory expression of HOXA10 and CD44 was correlated with poor gastric cancer prognosis. |
26478432 | Promoter activity of HOXA10 lies in 5.3-6.1 kb upstream of protein coding region.CTCF negatively regulates HOXA10 expression in breast cancer cells.CTCF flanks important promoter element of HOXA10. |
26151663 | confirmed that HOXA10 promoted epithelialmesenchymal transition in ovarian cancer cells |
26056923 | Peri-implantation HOXA-10 mRNA expression is increased following laparoscopic endometrioma resection. |
25757424 | The results showed overexpression of HOXA10 mRNA and protein in Ishikawa cell. |
25622821 | the CpG island of the HOXA10 alternative promoter appears to escape hypermethylation in the HOX-high glioblastoma. |
25500095 | miR-494 repressed the expression of HOXA10 and also reduced the proliferation of oral cancer cells. These data give more evidence of the role of miR-494 as a tumor suppressor miRNA in oral cancer. |
25307539 | Data show that recruitment of MLL1 (mixed lineage leukaemia histone methylase 1) to the homeobox-containing gene HOXA10 EREs (estrogen response elements) is mediated via ERalpha (estrogen receptor alpha). |
25217304 | HOXA10 is expressed in rectosigmoid endometriosis, where it likely imparts the de novo identity of endometriotic lesions. |
More... |
MSARKGYLLPSPNYPTTMSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPPAAD 1 - 70 LPYGLQSCGLFPTLGGKRNEAASPGSGGGGGGLGPGAHGYGPSPIDLWLDAPRSCRMEPPDGPPPPPQQQ 71 - 140 PPPPPQPPQPAPQATSCSFAQNIKEESSYCLYDSADKCPKVSATAAELAPFPRGPPPDGCALGTSSGVPV 141 - 210 PGYFRLSQAYGTAKGYGSGGGGAQQLGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLAC 211 - 280 GSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAANWLTAKSGRKKRCPYTKHQTLE 281 - 350 LEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS 351 - 410 //
PMID | Year | Title |
---|---|---|
26552702 | 2015 | The Role of Hox Genes in Female Reproductive Tract Development, Adult Function, and Fertility. |
26552644 | 2015 | Overexpression of HOXA10 promotes gastric cancer cells proliferation and HOXA10(+)/CD44(+) is potential prognostic biomarker for gastric cancer. |
26478432 | 2015 | CTCF negatively regulates HOXA10 expression in breast cancer cells. |
26151663 | 2015 | Activation of ARK5/miR-1181/HOXA10 axis promotes epithelial-mesenchymal transition in ovarian cancer. |
26056923 | 2015 | Laparoscopic endometrioma resection increases peri-implantation endometrial HOXA-10 and HOXA-11 mRNA expression. |
26018586 | 2015 | Anterior migration of lateral plate mesodermal cells during embryogenesis of the pufferfish Takifugu niphobles: insight into the rostral positioning of pelvic fins. |
25757424 | 2015 | Identification of LncRNAs/mRNAs related to endometrium function regulated by Homeobox A10 in Ishikawa cells. |
25622821 | 2015 | Chromosome 7 gain and DNA hypermethylation at the HOXA10 locus are associated with expression of a stem cell related HOX-signature in glioblastoma. |
25500095 | 2015 | miR-494 represses HOXA10 expression and inhibits cell proliferation in oral cancer. |
25307539 | 2014 | Mixed lineage leukaemia histone methylases 1 collaborate with ER? to regulate HOXA10 expression in AML. |
More... |