Property Summary

NCBI Gene PubMed Count 133
PubMed Score 199.23
PubTator Score 184.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 2.83243589438035E-11
acute quadriplegic myopathy 1157 3.50057160866987E-5
psoriasis 6685 7.10108666950747E-5
pancreatic cancer 2300 1.98723213895044E-4
adult high grade glioma 2148 2.31913779721967E-4
Atopic dermatitis 944 3.15471883417777E-4
nasopharyngeal carcinoma 1056 5.26048734947093E-4
glioblastoma 5572 5.68424585817007E-4
interstitial cystitis 2299 9.26783475487815E-4
invasive ductal carcinoma 2950 0.00167840797863495
sonic hedgehog group medulloblastoma 1482 0.00169000654235656
cutaneous lupus erythematosus 1056 0.00907785008608388
esophageal adenocarcinoma 737 0.0190553920760902
ductal carcinoma in situ 1745 0.0252005380164751
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0345480650596566
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0457783060995613

Expression

Synonym

Accession P31260 O43370 O43605 Q15949 Q504T1
Symbols PL
HOX1
HOX1H
HOX1.8

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (107)

PMID Text
26552702 Regulated HOXA10 and HOXA11 expression is necessary for endometrial receptivity; decreased HOXA10 or HOXA11 expression leads to decreased implantation rates. Alternation of HOXA10 and HOXA11 expression has been identified as a mechanism of the decreased implantation associated with endometriosis, polycystic ovarian syndrome, leiomyoma, polyps, adenomyosis, and hydrosalpinx.
26552644 The combinatory expression of HOXA10 and CD44 was correlated with poor gastric cancer prognosis.
26478432 Promoter activity of HOXA10 lies in 5.3-6.1 kb upstream of protein coding region.CTCF negatively regulates HOXA10 expression in breast cancer cells.CTCF flanks important promoter element of HOXA10.
26151663 confirmed that HOXA10 promoted epithelialmesenchymal transition in ovarian cancer cells
26056923 Peri-implantation HOXA-10 mRNA expression is increased following laparoscopic endometrioma resection.
25757424 The results showed overexpression of HOXA10 mRNA and protein in Ishikawa cell.
25622821 the CpG island of the HOXA10 alternative promoter appears to escape hypermethylation in the HOX-high glioblastoma.
25500095 miR-494 repressed the expression of HOXA10 and also reduced the proliferation of oral cancer cells. These data give more evidence of the role of miR-494 as a tumor suppressor miRNA in oral cancer.
25307539 Data show that recruitment of MLL1 (mixed lineage leukaemia histone methylase 1) to the homeobox-containing gene HOXA10 EREs (estrogen response elements) is mediated via ERalpha (estrogen receptor alpha).
25217304 HOXA10 is expressed in rectosigmoid endometriosis, where it likely imparts the de novo identity of endometriotic lesions.
More...

AA Sequence

MSARKGYLLPSPNYPTTMSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPPAAD      1 - 70
LPYGLQSCGLFPTLGGKRNEAASPGSGGGGGGLGPGAHGYGPSPIDLWLDAPRSCRMEPPDGPPPPPQQQ     71 - 140
PPPPPQPPQPAPQATSCSFAQNIKEESSYCLYDSADKCPKVSATAAELAPFPRGPPPDGCALGTSSGVPV    141 - 210
PGYFRLSQAYGTAKGYGSGGGGAQQLGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLAC    211 - 280
GSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAANWLTAKSGRKKRCPYTKHQTLE    281 - 350
LEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS              351 - 410
//

Text Mined References (134)

PMID Year Title
26552702 2015 The Role of Hox Genes in Female Reproductive Tract Development, Adult Function, and Fertility.
26552644 2015 Overexpression of HOXA10 promotes gastric cancer cells proliferation and HOXA10(+)/CD44(+) is potential prognostic biomarker for gastric cancer.
26478432 2015 CTCF negatively regulates HOXA10 expression in breast cancer cells.
26151663 2015 Activation of ARK5/miR-1181/HOXA10 axis promotes epithelial-mesenchymal transition in ovarian cancer.
26056923 2015 Laparoscopic endometrioma resection increases peri-implantation endometrial HOXA-10 and HOXA-11 mRNA expression.
26018586 2015 Anterior migration of lateral plate mesodermal cells during embryogenesis of the pufferfish Takifugu niphobles: insight into the rostral positioning of pelvic fins.
25757424 2015 Identification of LncRNAs/mRNAs related to endometrium function regulated by Homeobox A10 in Ishikawa cells.
25622821 2015 Chromosome 7 gain and DNA hypermethylation at the HOXA10 locus are associated with expression of a stem cell related HOX-signature in glioblastoma.
25500095 2015 miR-494 represses HOXA10 expression and inhibits cell proliferation in oral cancer.
25307539 2014 Mixed lineage leukaemia histone methylases 1 collaborate with ER? to regulate HOXA10 expression in AML.
More...