| Tbio | Homeobox protein Hox-A10 |
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Binds to the DNA sequence 5'-AA[AT]TTTTATTAC-3'.
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor that may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function in fertility, embryo viability, and regulation of hematopoietic lineage commitment. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the downstream homeobox A9 (HOXA9) gene. [provided by RefSeq, Mar 2011]
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor that may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function in fertility, embryo viability, and regulation of hematopoietic lineage commitment. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the downstream homeobox A9 (HOXA9) gene. [provided by RefSeq, Mar 2011]
Comments
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Adenocarcinoma | 122 | 0.0 | 0.0 |
| Endometrial Neoplasms | 55 | 0.0 | 0.0 |
| Female Urogenital Diseases | 18 | 0.0 | 0.0 |
| Disease | Target Count | P-value |
|---|---|---|
| non-small cell lung cancer | 2890 | 2.8e-11 |
| acute quadriplegic myopathy | 1158 | 3.5e-05 |
| psoriasis | 6694 | 7.1e-05 |
| pancreatic cancer | 2398 | 2.0e-04 |
| adult high grade glioma | 3801 | 2.3e-04 |
| Atopic dermatitis | 952 | 3.2e-04 |
| nasopharyngeal carcinoma | 1058 | 5.3e-04 |
| glioblastoma | 5792 | 5.7e-04 |
| cutaneous lupus erythematosus | 1057 | 1.6e-03 |
| interstitial cystitis | 2312 | 1.6e-03 |
| invasive ductal carcinoma | 2951 | 1.7e-03 |
| esophageal adenocarcinoma | 737 | 1.9e-02 |
| ductal carcinoma in situ | 1745 | 2.5e-02 |
| intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 2.7e-02 |
| group 3 medulloblastoma | 4104 | 3.1e-02 |
| intraductal papillary-mucinous neoplasm (IPMN) | 3291 | 4.6e-02 |
| Disease | log2 FC | p |
|---|---|---|
| acute quadriplegic myopathy | -1.200 | 3.5e-05 |
| adult high grade glioma | 2.100 | 2.3e-04 |
| Atopic dermatitis | -1.500 | 3.2e-04 |
| cutaneous lupus erythematosus | -2.100 | 1.6e-03 |
| ductal carcinoma in situ | -1.500 | 2.5e-02 |
| esophageal adenocarcinoma | 1.700 | 1.9e-02 |
| glioblastoma | 2.000 | 5.7e-04 |
| group 3 medulloblastoma | 1.300 | 3.1e-02 |
| interstitial cystitis | -1.100 | 1.6e-03 |
| intraductal papillary-mucinous carcinoma... | 1.100 | 2.7e-02 |
| intraductal papillary-mucinous neoplasm ... | 1.200 | 4.6e-02 |
| invasive ductal carcinoma | -2.700 | 1.7e-03 |
| nasopharyngeal carcinoma | 1.300 | 5.3e-04 |
| non-small cell lung cancer | 1.688 | 2.8e-11 |
| pancreatic cancer | 1.700 | 2.0e-04 |
| psoriasis | -1.400 | 7.1e-05 |
MSARKGYLLPSPNYPTTMSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPPAAD 1 - 70 LPYGLQSCGLFPTLGGKRNEAASPGSGGGGGGLGPGAHGYGPSPIDLWLDAPRSCRMEPPDGPPPPPQQQ 71 - 140 PPPPPQPPQPAPQATSCSFAQNIKEESSYCLYDSADKCPKVSATAAELAPFPRGPPPDGCALGTSSGVPV 141 - 210 PGYFRLSQAYGTAKGYGSGGGGAQQLGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLAC 211 - 280 GSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAANWLTAKSGRKKRCPYTKHQTLE 281 - 350 LEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS 351 - 410 //
