Property Summary

NCBI Gene PubMed Count 142
PubMed Score 210.59
PubTator Score 184.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy -1.200 3.5e-05
adult high grade glioma 2.100 2.3e-04
Atopic dermatitis -1.500 3.2e-04
cutaneous lupus erythematosus -2.100 1.6e-03
ductal carcinoma in situ -1.500 2.5e-02
esophageal adenocarcinoma 1.700 1.9e-02
glioblastoma 2.000 5.7e-04
group 3 medulloblastoma 1.300 3.1e-02
interstitial cystitis -1.100 1.6e-03
intraductal papillary-mucinous carcinoma... 1.100 2.7e-02
intraductal papillary-mucinous neoplasm ... 1.200 4.6e-02
invasive ductal carcinoma -2.700 1.7e-03
nasopharyngeal carcinoma 1.300 5.3e-04
non-small cell lung cancer 1.688 2.8e-11
pancreatic cancer 1.700 2.0e-04
psoriasis -1.400 7.1e-05

Gene RIF (116)

AA Sequence

MSARKGYLLPSPNYPTTMSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPPAAD      1 - 70
LPYGLQSCGLFPTLGGKRNEAASPGSGGGGGGLGPGAHGYGPSPIDLWLDAPRSCRMEPPDGPPPPPQQQ     71 - 140
PPPPPQPPQPAPQATSCSFAQNIKEESSYCLYDSADKCPKVSATAAELAPFPRGPPPDGCALGTSSGVPV    141 - 210
PGYFRLSQAYGTAKGYGSGGGGAQQLGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLAC    211 - 280
GSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAANWLTAKSGRKKRCPYTKHQTLE    281 - 350
LEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS              351 - 410
//

Text Mined References (143)

PMID Year Title