Property Summary

NCBI Gene PubMed Count 35
Grant Count 21
R01 Count 11
Funding $2,284,188.75
PubMed Score 39.29
PubTator Score 30.08

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
24847526 HOXD3 promoter hypermethylation is correlated with clinicopathologic features in prostate cancer. This correlation is more common in older, higher risk patients.
24718283 These results validate the association between promoter hypermethylation of ABHD9 and HOXD3 and prostate cancer recurrence
24127533 describe familial cases of TH in two generations (proband and his father), in addition to other two sporadic cases. We have found polymorphisms in the HOXB3, HOXD3, and a new synonymous variant, and PITX2 genes
22935821 High expression of HOXD3 correlates with invasive breast cancer.
21207416 quantitative increase in promoter methylation levels of HOXD3 is associated with prostate cancer progression
20212450 HOXD3 methylation distinguishes low-grade prostate cancers from intermediate and high-grade ones.
19938081 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19283074 Further validation of candidate genes on a separate cohort of low and high grade prostate cancers by quantitative MethyLight analysis has allowed us to confirm DNA hypermethylation of HOXD3 and BMP7...
17785556 Study identified hypermethylation and gene inactivation of HOXA4 and HOXA5 was frequently observed (26-79%) in all types of leukemias studied.
More...

AA Sequence

MLFEQGQQALELPECTMQKAAYYENPGLFGGYGYSKTTDTYGYSTPHQPYPPPAAASSLDTDYPGSACSI      1 - 70
QSSAPLRAPAHKGAELNGSCMRPGTGNSQGGGGGSQPPGLNSEQQPPQPPPPPPTLPPSSPTNPGGGVPA     71 - 140
KKPKGGPNASSSSATISKQIFPWMKESRQNSKQKNSCATAGESCEDKSPPGPASKRVRTAYTSAQLVELE    141 - 210
KEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKAKGILHSPASQSPERSPPLGGAAGHV    211 - 280
AYSGQLPPVPGLAYDAPSPPAFAKSQPNMYGLAAYTAPLSSCLPQQKRYAAPEFEPHPMASNGGGFASAN    281 - 350
LQGSPVYVGGNFVESMAPASGPVFNLGHLSHPSSASVDYSCAAQIPGNHHHGPCDPHPTYTDLSAHHSSQ    351 - 420
GRLPEAPKLTHL                                                              421 - 432
//

Text Mined References (36)

PMID Year Title
24847526 2014 Correlation of HOXD3 promoter hypermethylation with clinical and pathologic features in screening prostate biopsies.
24718283 2014 Validation study of genes with hypermethylated promoter regions associated with prostate cancer recurrence.
24127533 2014 The absence of mutations in homeobox candidate genes HOXA3, HOXB3, HOXD3 and PITX2 in familial and sporadic thyroid hemiagenesis.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
22935821 2013 Expression of HOXD3 correlates with shorter survival in patients with invasive breast cancer.
21207416 2011 Association of tissue promoter methylation levels of APC, TGF?2, HOXD3 and RASSF1A with prostate cancer progression.
20852632 2010 A genome-wide association study identifies susceptibility loci for ovarian cancer at 2q31 and 8q24.
20212450 2010 DNA methylation of HOXD3 as a marker of prostate cancer progression.
19938081 2009 Altered transmission of HOX and apoptotic SNPs identify a potential common pathway for clubfoot.
More...