Property Summary

NCBI Gene PubMed Count 211
PubMed Score 0.00
PubTator Score 303.05

Knowledge Summary

Patent

No data available

Synonym

Accession P31213 B2RE87 Q2M1R4 Q9BYE6
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (219)

PMID Text
26751392 Metabolic syndrome develops more frequently in testicular cancer survivors homozygous or heterozygous variant for SNP rs523349 in SRD5A2.
26453174 Diagnosis of 5alpha-reductase 2 deficiency with assessment of the SRD5A2 gene may help in appropriate gender assignment.
26345832 the V89L and TA repeat polymorphisms of SRD5A2 gene were found to have no significant associations with breast cancer
26332453 In prostate cancer, increased DNA methylation of SRD5A2 and CYP11A1 related to androgen biosynthesis functions may play a role in biochemical recurrence after patients' prostatectomy
26174685 the genotypic distribution of 22 single nucleotide polymorphisms in SRD5A1 and SRD5A2 in a set of Spanish prostate cancer patients, were evaluated.
26169017 High 5alpha-reductase activity due to the polymorphism in SRD5A2 may contribute to resistance to androgen deprivation therapy.
26092425 Results suggest that SRD5A2 controls cell migration by indirectly regulating ERK/MAPK pathway in prostate cancer cells.
25974403 Manipulation of SRD5A2 activity can regulate lipogenesis in human hepatocytes in vitro.
25735326 SRD5A2 gene polymorphisms are associated with the risk of benign prostatic hyperplasia but not prostate cancer.
25700986 methylation of SRD5A2 is regulated by DNA methyltransferase 1, and inflammatory mediators such as tumor necrosis factor alpha, NF-kappaB, and IL-6 regulate DNA methyltransferase 1 expression and thereby affect SRD5A2 promoter methylation and gene expression.
More...

AA Sequence

MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILAR      1 - 70
QPLSLFGPPGTVLLGLFCVHYFHRTFVYSLLNRGRPYPAILILRGTAFCTGNGVLQGYYLIYCAEYPDGW     71 - 140
YTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRIPQGGLFTYVSGANFLGEIIEWIGYALATWS    141 - 210
LPALAFAFFSLCFLGLRAFHHHRFYLKMFEDYPKSRKALIPFIF                              211 - 254
//

Text Mined References (215)

PMID Year Title
26751392 2016 Single-nucleotide polymorphism in the 5-?-reductase gene (SRD5A2) is associated with increased prevalence of metabolic syndrome in chemotherapy-treated testicular cancer survivors.
26453174 2015 Phenotype, genotype and gender identity in a large cohort of patients from India with 5?-reductase 2 deficiency.
26345832 2015 Associations between the SRD5A2 gene V89L and TA repeat polymorphisms and breast cancer risk: a meta-analysis.
26332453 2015 DNA methylation screening of primary prostate tumors identifies SRD5A2 and CYP11A1 as candidate markers for assessing risk of biochemical recurrence.
26174685 2015 Intraethnic variation in steroid-5-alpha-reductase polymorphismsin prostate cancer patients: a potential factor implicated in 5-alpha-reductase inhibitor treatment.
26169017 2015 SRD5A gene polymorphism in Japanese men predicts prognosis of metastatic prostate cancer with androgen-deprivation therapy.
26092425 2015 SRD5A2 gene expression inhibits cell migration and invasion in prostate cancer cell line via F-actin reorganization.
25974403 2015 5?-Reductase Type 2 Regulates Glucocorticoid Action and Metabolic Phenotype in Human Hepatocytes.
25735326 2015 SRD5A2 gene polymorphisms and the risk of benign prostatic hyperplasia but not prostate cancer.
25700986 2015 DNA methyl transferase 1 reduces expression of SRD5A2 in the aging adult prostate.
More...