Property Summary

NCBI Gene PubMed Count 37
Grant Count 75
R01 Count 65
Funding $7,721,672.48
PubMed Score 75.48
PubTator Score 59.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.459 0.003
astrocytic glioma 1.400 0.031
oligodendroglioma 1.300 0.009
osteosarcoma 2.763 0.000
ependymoma 1.700 0.000
group 4 medulloblastoma 2.200 0.000
atypical teratoid / rhabdoid tumor 1.900 0.001
glioblastoma 1.800 0.002
medulloblastoma, large-cell 3.000 0.000
primitive neuroectodermal tumor 1.100 0.002
primary pancreatic ductal adenocarcinoma -1.146 0.041
non-small cell lung cancer -1.039 0.000
pediatric high grade glioma 1.300 0.007
lung adenocarcinoma 1.035 0.000
COPD -1.100 0.003
Alzheimer's disease -1.200 0.036
Pick disease -1.700 0.000
progressive supranuclear palsy -1.500 0.010
Down syndrome 1.300 0.002
chronic rhinosinusitis -1.197 0.018
pancreatic cancer -1.100 0.028
dermatomyositis 1.300 0.000

Synonym

Accession P31153 A8K511 B4DN45 D6W5L1 Q53SP5 AdoMet synthase 2
Symbols MATA2
MATII
SAMS2

Gene

PANTHER Protein Class (2)

PDB

4KTT   4KTV   4NDN   2P02   5A19   5A1G   5A1I  

Gene RIF (27)

PMID Text
26858410 crystal structures of human MATalpha2 containing various bound ligands.
25925782 acetylation decreased in hepatocellular cancer
25557781 The data presented here support the conclusion that rare genetic variants in MAT2A predispose individuals to thoracic aortic disease.
25294683 Mutagenesis of MATalpha2 and MATbeta phospho-sites destabilized them and prevented hepatic stellate cell trans-differentiation.
24636201 Results suggest that MAT2A is downregulated in cancer tissues of renal cell carcinomas patients and has function of tumor suppressor though repressing the expression of heme oxygenase-1.
23425511 Liver-specific isoenzyme MAT1A is genetically linked with an inborn metabolic disorder of hypermethioninemia, as well as a ubiquitously expressed isoenzyme MAT2A, whose enzymatic activity is regulated by an associated subunit MAT2B.
22879628 Differential gene expression of BACE1 and PSEN1 in the knockdown cells, which is possibly a consequence of MAT2A deregulation and may indicate a self regulatory mechanism.
22318685 we found for the first time a post-transcriptional regulation of MAT1A and MAT2A by AUF1 and HuR in hepatocellular carcinoma.
21460102 hypoxia-induced MAT2A expression is HIF-1alpha dependent
21406062 Insulin-like growth factor 1 (IGF1) activates methionine adenosyltransferase 2A MAT2A) transcription by both known and novel pathways in colon cancer cells.
More...

AA Sequence

MNGQLNGFHEAFIEEGTFLFTSESVGEGHPDKICDQISDAVLDAHLQQDPDAKVACETVAKTGMILLAGE      1 - 70
ITSRAAVDYQKVVREAVKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQGVHLDRNEEDIGAGDQGLMFG     71 - 140
YATDETEECMPLTIVLAHKLNAKLAELRRNGTLPWLRPDSKTQVTVQYMQDRGAVLPIRVHTIVISVQHD    141 - 210
EEVCLDEMRDALKEKVIKAVVPAKYLDEDTIYHLQPSGRFVIGGPQGDAGLTGRKIIVDTYGGWGAHGGG    211 - 280
AFSGKDYTKVDRSAAYAARWVAKSLVKGGLCRRVLVQVSYAIGVSHPLSISIFHYGTSQKSERELLEIVK    281 - 350
KNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLKY                             351 - 395
//

Text Mined References (43)

PMID Year Title
26858410 2016 Crystallography captures catalytic steps in human methionine adenosyltransferase enzymes.
25925782 2015 Acetylation of MAT II? represses tumour cell growth and is decreased in human hepatocellular cancer.
25557781 2015 MAT2A mutations predispose individuals to thoracic aortic aneurysms.
25416956 2014 A proteome-scale map of the human interactome network.
25294683 2015 Role of methionine adenosyltransferase ?2 and ? phosphorylation and stabilization in human hepatic stellate cell trans-differentiation.
25075345 2014 Structure and function study of the complex that synthesizes S-adenosylmethionine.
24636201 2014 Expression of methionine adenosyltransferase 2A in renal cell carcinomas and potential mechanism for kidney carcinogenesis.
23425511 2013 Insight into S-adenosylmethionine biosynthesis from the crystal structures of the human methionine adenosyltransferase catalytic and regulatory subunits.
23189196 2012 NADP+ binding to the regulatory subunit of methionine adenosyltransferase II increases intersubunit binding affinity in the hetero-trimer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...