Property Summary

NCBI Gene PubMed Count 43
PubMed Score 84.11
PubTator Score 59.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Alzheimer's disease -1.200 3.6e-02
astrocytic glioma 1.400 3.1e-02
atypical teratoid / rhabdoid tumor 1.900 1.2e-03
chronic rhinosinusitis -1.197 1.8e-02
COPD -1.100 3.0e-03
dermatomyositis 1.300 1.8e-04
Down syndrome 1.300 1.8e-03
ependymoma 1.700 2.0e-06
glioblastoma 1.800 1.8e-03
group 4 medulloblastoma 2.200 3.6e-04
lung adenocarcinoma 1.035 5.3e-06
medulloblastoma, large-cell 3.000 1.3e-05
non-small cell lung cancer -1.039 1.4e-18
oligodendroglioma 1.300 9.2e-03
osteosarcoma -1.421 1.3e-04
pancreatic cancer -1.100 2.8e-02
pediatric high grade glioma 1.300 7.4e-03
Pick disease -1.100 8.1e-05
primary pancreatic ductal adenocarcinoma -1.146 4.1e-02
primitive neuroectodermal tumor 1.100 2.5e-03
progressive supranuclear palsy -1.200 7.8e-03
Waldenstrons macroglobulinemia 1.459 2.5e-03

Gene RIF (31)

AA Sequence

MNGQLNGFHEAFIEEGTFLFTSESVGEGHPDKICDQISDAVLDAHLQQDPDAKVACETVAKTGMILLAGE      1 - 70
ITSRAAVDYQKVVREAVKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQGVHLDRNEEDIGAGDQGLMFG     71 - 140
YATDETEECMPLTIVLAHKLNAKLAELRRNGTLPWLRPDSKTQVTVQYMQDRGAVLPIRVHTIVISVQHD    141 - 210
EEVCLDEMRDALKEKVIKAVVPAKYLDEDTIYHLQPSGRFVIGGPQGDAGLTGRKIIVDTYGGWGAHGGG    211 - 280
AFSGKDYTKVDRSAAYAARWVAKSLVKGGLCRRVLVQVSYAIGVSHPLSISIFHYGTSQKSERELLEIVK    281 - 350
KNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLKY                             351 - 395
//

Text Mined References (49)

PMID Year Title