Property Summary

NCBI Gene PubMed Count 14
PubMed Score 13.03
PubTator Score 15.57

Knowledge Summary

Patent (1,710)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
aldosterone-producing adenoma -1.019 0.014
psoriasis -1.900 0.000

Synonym

Accession P31152 A1A4C4 Q0VG04 MAP kinase 4
Symbols ERK4
ERK-4
PRKM4
p63MAPK
p63-MAPK

Gene

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (4)

PMID Text
21177870 Activation loop phosphorylation of ERK3/ERK4 by group I p21-activated kinases (PAKs) defines a novel PAK-ERK3/4-MAPK-activated protein kinase 5 signaling pathway.
19473979 Data defined a novel MK5 interaction motif (FRIEDE) within both ERK4 and ERK3 that is essential for binding to the C-terminal region of MK5.
16973613 Data show that in contrast to ERK3, ERK4 (MAPK4) is a stable protein and binds to MAPKAPK-5. Interaction of ERK4 with MAPKAPK-5 leads to translocation of MAPKAPK-5 to the cytoplasm and to its activation by phosphorylation. ERK4 can form dimers with ERK3.
12239168 HIV-1 gp120 binding to CD4 results in activation of the mitogen-activated protein kinase (MAPK) in CD4(+) lymphocytes prestimulated through their T-cell receptor (TCR)

AA Sequence

MAEKGDCIASVYGYDLGGRFVDFQPLGFGVNGLVLSAVDSRACRKVAVKKIALSDARSMKHALREIKIIR      1 - 70
RLDHDNIVKVYEVLGPKGTDLQGELFKFSVAYIVQEYMETDLARLLEQGTLAEEHAKLFMYQLLRGLKYI     71 - 140
HSANVLHRDLKPANIFISTEDLVLKIGDFGLARIVDQHYSHKGYLSEGLVTKWYRSPRLLLSPNNYTKAI    141 - 210
DMWAAGCILAEMLTGRMLFAGAHELEQMQLILETIPVIREEDKDELLRVMPSFVSSTWEVKRPLRKLLPE    211 - 280
VNSEAIDFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDDIVLMAANQSQLSNW    281 - 350
DTCSSRYPVSLSSDLEWRPDRCQDASEVQRDPRAGSAPLAEDVQVDPRKDSHSSSERFLEQSHSSMERAF    351 - 420
EADYGRSCDYKVGSPSYLDKLLWRDNKPHHYSEPKLILDLSHWKQAAGAPPTATGLADTGAREDEPASLF    421 - 490
LEIAQWVKSTQGGPEHASPPADDPERRLSASPPGRPAPVDGGASPQFDLDVFISRALKLCTKPEDLPDNK    491 - 560
LGDLNGACIPEHPGDLVQTEAFSKERW                                               561 - 587
//

Text Mined References (20)

PMID Year Title
24651460 2014 Comparative molecular dynamics simulations of mitogen-activated protein kinase-activated protein kinase 5.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22800433 2012 Tumour promoting and suppressing roles of the atypical MAP kinase signalling pathway ERK3/4-MK5.
22046431 2011 Evolutionary history of the vertebrate mitogen activated protein kinases family.
21177870 2011 Activation loop phosphorylation of ERK3/ERK4 by group I p21-activated kinases (PAKs) defines a novel PAK-ERK3/4-MAPK-activated protein kinase 5 signaling pathway.
19473979 2009 Docking of PRAK/MK5 to the atypical MAPKs ERK3 and ERK4 defines a novel MAPK interaction motif.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16973613 2006 Characterization of the atypical MAPK ERK4 and its activation of the MAPK-activated protein kinase MK5.
More...