Property Summary

NCBI Gene PubMed Count 111
Grant Count 26
R01 Count 19
Funding $2,435,794.98
PubMed Score 190.40
PubTator Score 147.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 6.800 0.000

Gene RIF (79)

PMID Text
26173840 rs3014837 polymorphism associated with calcium level in serum of psoriasis patients
26053695 S100A7 acts as a dual regulator in promoting proliferation and suppressing squamous differentiation of squamous cell carcinomas.
25651379 overexpression of S100A7 in A431 skin squamous carcinoma cells significantly promoted cell proliferation in vitro and tumor growth in vivo, whereas it suppressed the expression of GATA-3 and caspase-14
25622979 The distinct modulations of the NF-kappaB - miR-29b - p53 pathway make S100A7 an oncogene.
25572331 found that RAGE/S100A7 conditioned the tumor microenvironment by driving the recruitment of MMP9-positive tumor-associated macrophages
25550886 Our present results suggest that S100A7 level is a promising tool for diagnosis of lung squamous cell carcinoma. Knockdown of S100A7 suppresses lung cancer growth
25514480 decreased expression in nasal epithelia of allergic rhinitis patients
25502330 The antimicrobial peptides psoriasin (S100A7) and koebnerisin (S100A15) suppress extracellular matrix production and proliferation of human fibroblasts
25256120 present a novel signalling mechanism by which IL-17A can induce Egr-1-dependent psoriasin expression via the ERK pathway in keratinocytes
24842328 The antimicrobial peptide psoriasin has immunoregulatory activities and is involved in skin innate immunity.
More...

AA Sequence

MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKI      1 - 70
DFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ                                            71 - 101
//

Text Mined References (113)

PMID Year Title
26173840 2015 Association of S100A7 gene polymorphisms with manifestations of common types of psoriasis: effect on serum calcium levels.
26053695 2015 The Characteristics and Function of S100A7 Induction in Squamous Cell Carcinoma: Heterogeneity, Promotion of Cell Proliferation and Suppression of Differentiation.
25651379 2015 S100A7 acts as a dual regulator in promoting proliferation and suppressing squamous differentiation through GATA-3/caspase-14 pathway in A431 cells.
25622979 2015 miR-29b defines the pro-/anti-proliferative effects of S100A7 in breast cancer.
25572331 2015 RAGE mediates S100A7-induced breast cancer growth and metastasis by modulating the tumor microenvironment.
25550886 2014 Knockdown of S100A7 reduces lung squamous cell carcinoma cell growth in vitro and in vivo.
25514480 Th2 cytokines differentially regulate psoriasin expression in human nasal epithelia.
25502330 2015 The antimicrobial peptides psoriasin (S100A7) and koebnerisin (S100A15) suppress extracellular matrix production and proliferation of human fibroblasts.
25256120 2014 Egr-1 is a key regulator of IL-17A-induced psoriasin upregulation in psoriasis.
24842328 2014 The antimicrobial protein S100A7/psoriasin enhances the expression of keratinocyte differentiation markers and strengthens the skin's tight junction barrier.
More...