Property Summary

NCBI Gene PubMed Count 47
Grant Count 95
R01 Count 60
Funding $6,295,194.33
PubMed Score 132.56
PubTator Score 87.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Multiple myeloma 1.332 0.024
ependymoma -1.400 0.009
oligodendroglioma -1.300 0.009
cutaneous lupus erythematosus 1.800 0.002
osteosarcoma -3.670 0.000
medulloblastoma -2.100 0.000
glioblastoma 1.400 0.002
periodontitis 1.100 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -3.000 0.000
primitive neuroectodermal tumor -1.300 0.002
ulcerative colitis 2.100 0.001
adrenocortical carcinoma -1.243 0.003
Hydrolethalus syndrome -1.007 0.046
lung cancer -1.200 0.001
interstitial cystitis 2.200 0.002
primary Sjogren syndrome 1.200 0.017
invasive ductal carcinoma 1.424 0.001
psoriasis 1.100 0.000
lung carcinoma -1.600 0.000
spina bifida 1.376 0.037
ovarian cancer 1.400 0.004

Synonym

Accession P31146 B2RBL1 Q2YD73
Symbols p57
IMD8
TACO
CLABP
HCORO1
CLIPINA

Gene

Gene RIF (23)

PMID Text
26476480 Our studies demonstrate the importance of intact CORO1A C-terminal domains in thymic egress and T-cell survival, as well as in defense against viral pathogens.
25936522 These findings suggest that coronin 1A modulates endothelial cell apoptosis by regulating p38beta expression and activation.
25889880 Together, these findings both in Jurkat T cells as well as in primary T cells indicate a regulatory role of Coro1A on PKCtheta; recruitment and function downstream of the TCR leading to NF-kappaB transactivation.
25269405 Absence of coronin 1A is associated with severe combined immunodeficiency in humans, hypomorphic mutations lead to a profound defect in naive T cells, expansion of oligoclonal memory T cells, and susceptibility to Epstein Barr B lymphoproliferation.
25217836 Coronin 1 trimerization is essential to promote mycobacterial survival within macrophages
25073507 mutatiions result in abnormal T-cells, severe combined immunodeficiency of an epidermodysplasia verruciformis-human papilloma virus mucocutaneous syndrome with B and NK defects and shortened telomeres
24980436 Results indicate that Coronin1 proteins are at the center of a regulatory hub that coordinates Rac1 activation, effector exchange, and the F-actin organization state during cell signaling.
24760828 show a critical role for F-actin deconstruction in cytotoxic function and immunological secretion and identify Coro1A as its mediator
24239742 Nox4-mediated redox regulation of PTP1B serves as a modulator, in part through coronin-1C, of the growth and migration of glioblastoma cells.
23745754 These results demonstrate that coronin-1a is a novel antibody target for clinically isolated syndrome and multiple sclerosis.
More...

AA Sequence

MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFLVLPLGKTGRV      1 - 70
DKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPLREPVVTLEGHTKRVGIVAWH     71 - 140
TTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIYSVDWSRDGGLICTSCRDKRVRIIEPRKGTV    141 - 210
VAEKDRPHEGTRPVRAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTN    211 - 280
IVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAM    281 - 350
TVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPE    351 - 420
ASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK                                 421 - 461
//

Text Mined References (54)

PMID Year Title
26476480 2016 Recurrent viral infections associated with a homozygous CORO1A mutation that disrupts oligomerization and cytoskeletal association.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25936522 2015 Coronin 1A depletion protects endothelial cells from TNF?-induced apoptosis by modulating p38? expression and activation.
25889880 2015 Novel protein kinase C ?: coronin 1A complex in T lymphocytes.
25416956 2014 A proteome-scale map of the human interactome network.
25269405 2014 The expanding spectrum of human coronin 1A deficiency.
25217836 2014 Coronin 1 trimerization is essential to protect pathogenic mycobacteria within macrophages from lysosomal delivery.
25073507 2014 Compound heterozygous CORO1A mutations in siblings with a mucocutaneous-immunodeficiency syndrome of epidermodysplasia verruciformis-HPV, molluscum contagiosum and granulomatous tuberculoid leprosy.
24980436 2014 Coronin1 proteins dictate rac1 intracellular dynamics and cytoskeletal output.
24760828 2014 Lytic immune synapse function requires filamentous actin deconstruction by Coronin 1A.
More...