Property Summary

NCBI Gene PubMed Count 38
Grant Count 36
R01 Count 32
Funding $7,920,426.41
PubMed Score 218.55
PubTator Score 99.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Dry eye syndrome 13 3.887 1.9

Expression

Gene RIF (22)

PMID Text
26366224 the possible relationship between ocular symptomatology, tear volume and tear break-up time (TBUT) and lipocalin, lactoferrin and lysozyme concentrations in the tear film were explored in a group of symptomatic dry-eyed postmenopausal (PM) women.
26218644 the crosstalk of dendritic cells with lipocalins alone has the potential to direct the type of immune response to these particular antigens.
26135974 Human neutrophil lipocalin (HNL) concentrations in serum or whole blood activated by formyl-methionine-leucine-phenylalanine (fMLP) were shown to distinguish acute infections of bacterial or viral cause with high accuracy.
25914748 Tear lysozyme, lactoferrin and lipocalin concentrations were determined via electrophoresis and the results for patients with or without eyelid tumors were compared.
24920892 Serum concentrations of LCN1 and LCN2 were both elevated in patients with COPD.
21791187 Tear lipocalin (TLC) is a major protein in tears and has a large ligand-binding cavity that allows the lipocalin to bind an extensive and diverse set of lipophilic molecules.
21466861 The conserved disulfide bond of human tear lipocalin modulates conformation and lipid binding in a ligand selective manner.(
21324447 Study has identified the first protein, lipocalin-1, in the secretome of human blastocysts that is associated with chromosome aneuploidy.
19770509 Tear lipocalin with the bound artificial ligand 1,4-butanediol has been crystallized in space group P2(1) with four protein molecules in the asymmetric unit and its X-ray structure has been solved at 2.6 A resolution.
19586017 Results suggest that the excited protein states in tear lipocalin are not unique but consist of many substates.
More...

AA Sequence

MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAK      1 - 70
VTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKN     71 - 140
NLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD                                      141 - 176
//

Text Mined References (40)

PMID Year Title
26366224 2015 Tear lipocalin, lysozyme and lactoferrin concentrations in postmenopausal women.
26218644 2015 Allergenic Can f 1 and its human homologue Lcn-1 direct dendritic cells to induce divergent immune responses.
26135974 2015 Human Neutrophil Lipocalin as a Superior Diagnostic Means To Distinguish between Acute Bacterial and Viral Infections.
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25914748 Correlations between eyelid tumors and tear lipocalin, lysozyme and lactoferrin concentrations in postmenopausal women.
24920892 2014 Increased serum levels of lipocalin-1 and -2 in patients with stable chronic obstructive pulmonary disease.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21791187 2011 Tear lipocalin: structure and function.
More...