Property Summary

NCBI Gene PubMed Count 39
PubMed Score 221.27
PubTator Score 99.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Dry eye syndrome 18 4.028 2.0

Expression

Synonym

Accession P31025 Q5T8A1
Symbols TP
TLC
PMFA
VEGP

Gene

PANTHER Protein Class (1)

PDB

4QAF   1XKI   3EYC   5T43  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (22)

AA Sequence

MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAK      1 - 70
VTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKN     71 - 140
NLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD                                      141 - 176
//

Text Mined References (41)

PMID Year Title