Property Summary

NCBI Gene PubMed Count 83
Grant Count 512
R01 Count 283
Funding $76,148,960.05
PubMed Score 3485.07
PubTator Score 910.68

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P30990
Symbols NN
NT
NT/N
NTS1
NMN-125

Gene

NTS

PDB

2LNE   2LNF   2LNG   2LYW   2OYV   2OYW   3F6K   4PO7  

Gene RIF (58)

PMID Text
27193687 findings directly link NT with increased fat absorption and obesity and suggest that NT may provide a prognostic marker of future obesity and a potential target for prevention and treatment
25847417 Although no measures for pain threshold, thermal instability or gastric motility were performed in our study participants, higher plasma NT levels were found in PWS children
25724188 pretreatment of gastric cancer cells with NTR1 inhibitor SR48692 was shown to significantly inhibit the NT-mediated MMP-9 activity, cell invasion, and migration
25249545 Neurotensin and its receptor NTSR1 causes EGFR, HER2 and HER3 over-expression and their autocrine/paracrine activation in lung adenocarcinomas, confirming responsiveness to erlotinib.
25249538 NTS/NTSR1 complex enhances breast tumor aggressiveness via EGFR/HER2/HER3 pathway.
25200966 NTS/IL-8/CXCR1/STAT3 signaling is crucial for the maintenance of stem-like traits in glioblastoma stem cells .
25098665 indicate that neurotensin is a direct target of the Wnt/beta-catenin pathway and may be a mediator for neuroendocrine tumor cell growth
24198343 NT production by keratinocytes may exert a paracrine effect on other skin cells, namely fibroblasts, macrophages, and dendritic cells for correct wound healing.
24000330 These findings provide new insights into the potential therapeutic role of NT in chronic wounds, such as in DFU, characterized by a deficit in the migratory properties of cells and a chronic proinflammatory status.
23962427 Neurotensin-mediated calcium signaling appears more sensitive to differentiation than ATP-mediated Ca(2+) signaling
More...

AA Sequence

MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNS      1 - 70
PAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVI     71 - 140
KRKIPYILKRQLYENKPRRPYILKRDSYYY                                            141 - 170
//

Publication (84)

PMID Year Title
27193687 2016 An obligatory role for neurotensin in high-fat-diet-induced obesity.
25847417 2015 High plasma neurotensin levels in children with Prader-Willi syndrome.
25724188 2015 Activation of matrix metalloproteinase-9 (MMP-9) by neurotensin promotes cell invasion and migration through ERK pathway in gastric cancer.
25249545 2014 Neurotensin (NTS) and its receptor (NTSR1) causes EGFR, HER2 and HER3 over-expression and their autocrine/paracrine activation in lung tumors, confirming responsiveness to erlotinib.
25249538 2014 Activation of EGFR, HER2 and HER3 by neurotensin/neurotensin receptor 1 renders breast tumors aggressive yet highly responsive to lapatinib and metformin in mice.
25200966 2014 Neurotensin signaling regulates stem-like traits of glioblastoma stem cells through activation of IL-8/CXCR1/STAT3 pathway.
25098665 2015 Neurotensin, a novel target of Wnt/?-catenin pathway, promotes growth of neuroendocrine tumor cells.
24198343 2014 The effect of neurotensin in human keratinocytes--implication on impaired wound healing in diabetes.
24000330 2013 Neurotensin modulates the migratory and inflammatory response of macrophages under hyperglycemic conditions.
23962427 2013 Effects of differentiation on purinergic and neurotensin-mediated calcium signaling in human HT-29 colon cancer cells.
More...