Property Summary

NCBI Gene PubMed Count 87
PubMed Score 3627.64
PubTator Score 910.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.000 1.1e-03
ependymoma 1.700 3.0e-02
head and neck cancer -3.300 6.5e-03
head and neck cancer and chronic obstruc... -2.500 3.3e-03
lung cancer 1.400 7.6e-03
non-small cell lung cancer 3.840 6.4e-08
ovarian cancer 1.500 1.0e-02
pituitary cancer -2.400 1.2e-02
primitive neuroectodermal tumor 2.600 3.8e-02

Gene RIF (61)

AA Sequence

MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNS      1 - 70
PAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVI     71 - 140
KRKIPYILKRQLYENKPRRPYILKRDSYYY                                            141 - 170
//

Text Mined References (88)

PMID Year Title