Property Summary

Ligand Count 52
NCBI Gene PubMed Count 77
PubMed Score 841.85
PubTator Score 277.42

Knowledge Summary

Patent (52,493)

TINX Plot

  Disease (4)

Expression

 CSPA Cell Line (2)

Protein-protein Interaction (1)

Gene RIF (61)

AA Sequence

MRLNSSAPGTPGTPAADPFQRAQAGLEEALLAPGFGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVY      1 - 70
LALFVVGTVGNTVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLTLLLAMPVELYNFIWVHHPWAFGDAG     71 - 140
CRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGEQ    141 - 210
NRSADGQHAGGLVCTPTIHTATVKVVIQVNTFMSFIFPMVVISVLNTIIANKLTVMVRQAAEQGQVCTVG    211 - 280
GEHSTFSMAIEPGRVQALRHGVRVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTPFLYDFYHYFYMVTN    281 - 350
ALFYVSSTINPILYNLVSANFRHIFLATLACLCPVWRRRRKRPAFSRKADSVSSNHTLSSNATRETLY      351 - 418
//

Text Mined References (77)

PMID Year Title