Property Summary

NCBI Gene PubMed Count 71
Grant Count 222
R01 Count 78
Funding $40,131,685.81
PubMed Score 778.80
PubTator Score 277.42

Knowledge Summary

Patent (52,493)

TINX Plot

  Disease Relevance (4)

Expression

Synonym

Accession P30989 Q9H4H1 Q9H4T5 NT-R-1
Symbols NTR

Gene

PANTHER Protein Class (2)

PDB

2LYW  

  TechDev Info (1)

MLP Assay (11)

AID Type Active / Inconclusive / Inactive Description
493036 screening 557 / 1 / 331303 Image-Based HTS for Selective Agonists for NTR1
493055 summary 3 / 0 / 0 Summary Assay for Selective Agonists of NTR1
504549 confirmatory 138 / 0 / 47 Dose Response confirmation of Image-Based HTS for Selective Agonists for NTR1
504550 screening 184 / 0 / 294 Single concentration confirmation of Image-Based HTS for Selective Agonists for NTR1
602356 confirmatory 78 / 0 / 74 SAR analysis of small molecule Agonists NTR1 in a image based assay set 3
602426 confirmatory 1 / 0 / 0 SAR analysis of small molecule Agonists NTR1 in a image based assay set 4
602427 confirmatory 8 / 0 / 187 SAR analysis of small molecule agonists of the NTR1 receptor via a luminescent beta-arrestin assay
602459 confirmatory 3 / 0 / 1 SAR analysis of small molecule agonists of the NTR1 receptor in a dose response fluorescent-based calcium flux assay
602466 other 18 / 0 / 13 SAR analysis of small molecule agonists of the NTR1 receptor in a single concentration fluorescent-based calcium flux assay
602482 confirmatory 0 / 0 / 2 SAR analysis of small molecule agonists of the NTR1 receptor via a luminescent cytotoxicity assay
More...

Gene RIF (56)

PMID Text
26471393 Neurotensin receptor-targeted oncolytic adenovirus co-expressing decorin and Wnt antagonist useful for systemic treatment of NTR-overexpressing pancreatic cancer.
26334593 Data suggest that neurotensin receptor 1 (NTSR1) methylation may be a prognostic biomarker in colorectal cancers (CRCs).
26298774 high expression of NTSR1 is found in clinical NETs and promoter methylation is an important mechanism controlling the differential expression of NTSR1 and silencing of NTSR2 in NET cells
26215716 This study indicated that NTR1 may play an important role in tumor progression of gastric cancer
26205105 The presence of F358(7.42) causes the conserved W321(6.48) to adopt side chain orientation parallel to the lipid bilayer sealing the collapsed Na(+) ion pocket and linking the agonist with residues in the lower receptor part implicated in GPCR activation.
25644759 High expression levels of NTS and NTSR1 predict a poor prognosis in glioma patients.
25307345 the NTR1-HIF-1alpha-VEGFalpha axis has a role in intestinal angiogenic responses and in the pathophysiology of colitis and inflammatory bowel disease
25249545 Neurotensin and its receptor NTSR1 causes EGFR, HER2 and HER3 over-expression and their autocrine/paracrine activation in lung adenocarcinomas, confirming responsiveness to erlotinib.
25249538 NTS/NTSR1 complex enhances breast tumor aggressiveness via EGFR/HER2/HER3 pathway.
25175457 This review provides a summary of current knowledge, mainly emerging from microdialysis studies, supporting the presence of a neurotensin receptor 1/D2 receptor heteromer in the brain. [review]
More...

AA Sequence

MRLNSSAPGTPGTPAADPFQRAQAGLEEALLAPGFGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVY      1 - 70
LALFVVGTVGNTVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLTLLLAMPVELYNFIWVHHPWAFGDAG     71 - 140
CRGYYFLRDACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGEQ    141 - 210
NRSADGQHAGGLVCTPTIHTATVKVVIQVNTFMSFIFPMVVISVLNTIIANKLTVMVRQAAEQGQVCTVG    211 - 280
GEHSTFSMAIEPGRVQALRHGVRVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTPFLYDFYHYFYMVTN    281 - 350
ALFYVSSTINPILYNLVSANFRHIFLATLACLCPVWRRRRKRPAFSRKADSVSSNHTLSSNATRETLY      351 - 418
//

Publication (71)

PMID Year Title
26471393 2015 Potent antitumor effect of neurotensin receptor-targeted oncolytic adenovirus co-expressing decorin and Wnt antagonist in an orthotopic pancreatic tumor model.
26334593 2015 Epigenetic silencing of NTSR1 is associated with lateral and noninvasive growth of colorectal tumors.
26298774 2015 Differential expression and tumorigenic function of neurotensin receptor 1 in neuroendocrine tumor cells.
26215716 2015 The significance of NTR1 expression and its correlation with ?-catenin and EGFR in gastric cancer.
26205105 2015 Structural prerequisites for G-protein activation by the neurotensin receptor.
25644759 2015 Neurotensin promotes the progression of malignant glioma through NTSR1 and impacts the prognosis of glioma patients.
25307345 2014 The neurotensin-HIF-1?-VEGF? axis orchestrates hypoxia, colonic inflammation, and intestinal angiogenesis.
25249545 2014 Neurotensin (NTS) and its receptor (NTSR1) causes EGFR, HER2 and HER3 over-expression and their autocrine/paracrine activation in lung tumors, confirming responsiveness to erlotinib.
25249538 2014 Activation of EGFR, HER2 and HER3 by neurotensin/neurotensin receptor 1 renders breast tumors aggressive yet highly responsive to lapatinib and metformin in mice.
25175457 2014 Neurotensin NTS1-dopamine D2 receptor-receptor interactions in putative receptor heteromers: relevance for Parkinson's disease and schizophrenia.
More...