Property Summary

NCBI Gene PubMed Count 83
Grant Count 144
R01 Count 77
Funding $21,083,585.3
PubMed Score 315.10
PubTator Score 556.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.500 0.001

Synonym

Accession P30988 A4D1G6 F5H605 O14585 Q13941 Q5ZGL8 Q659U6 Q6DJU8 Q6T712 CT-R
Symbols CRT
CTR
CT-R
CTR1

Gene

PDB

5II0  

  TechDev Info (1)

 GWAS Trait (1)

Gene RIF (59)

PMID Text
26895962 Calcitonin and Amylin Receptor Peptide Interaction Mechanisms: INSIGHTS INTO PEPTIDE-BINDING MODES AND ALLOSTERIC MODULATION OF THE CALCITONIN RECEPTOR BY RECEPTOR ACTIVITY-MODIFYING PROTEINS.
25402775 An association between fluorosis and the Alu I polymorphism in the CTR gene was observed in fluoride-exposed populations.
25055932 The C1377T polymorphism in the CTR gene is associated with bone mineral density at the lumbar spine in a postmenopausal Han Chinese population
24643196 Prolonged calcitonin receptor signaling by salmon, but not human calcitonin, reveals ligand bias.
24522475 There was no statistically significant difference in CTR gene nucleotide sequence polymorphisms at 1377-bp between Chinese Xinjiang Han and Uygur patients with primary osteoporosis.
24296906 Data indicate a potential association between 3'UTR+18C>T and intron 1 polymorphisms in the CALCR and the risk of kidney stone disease.
23820954 High calcitonin receptor is associated with prostate cancer.
23137636 the polymorphic genotypes of BGLAP, ER1, Col1A1 and CALCR are not found to be associated with osteoporosis in a single form but found to be associated in combined forms.
22335784 CTR was expressed by glioma cells in a majority of GBM tumours tested.
21462477 Allele C in CALCR gene was associated with reduced bone mass in cystic fibrosis children.
More...

AA Sequence

MQFSGEKISGQRDLQKSKMRFTFTSRCLALFLLLNHPTPILPAFSNQTYPTIEPKPFLYVVGRKKMMDAQ      1 - 70
YKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHP     71 - 140
ENNRTWSNYTMCNAFTPEKLKNAYVLYYLAIVGHSLSIFTLVISLGIFVFFRKLTTIFPLNWKYRKALSL    141 - 210
GCQRVTLHKNMFLTYILNSMIIIIHLVEVVPNGELVRRDPVSCKILHFFHQYMMACNYFWMLCEGIYLHT    211 - 280
LIVVAVFTEKQRLRWYYLLGWGFPLVPTTIHAITRAVYFNDNCWLSVETHLLYIIHGPVMAALVVNFFFL    281 - 350
LNIVRVLVTKMRETHEAESHMYLKAVKATMILVPLLGIQFVVFPWRPSNKMLGKIYDYVMHSLIHFQGFF    351 - 420
VATIYCFCNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQEPRNEPANNQG    421 - 490
EESAEIIPLNIIEQESSA                                                        491 - 508
//

Text Mined References (88)

PMID Year Title
26895962 2016 Calcitonin and Amylin Receptor Peptide Interaction Mechanisms: INSIGHTS INTO PEPTIDE-BINDING MODES AND ALLOSTERIC MODULATION OF THE CALCITONIN RECEPTOR BY RECEPTOR ACTIVITY-MODIFYING PROTEINS.
25402775 2015 The relationship between Alu I polymorphisms in the calcitonin receptor gene and fluorosis endemic to Chongqing, China.
25055932 2015 Association of calcitonin receptor gene polymorphism with bone mineral density in postmenopausal Chinese women: a meta-analysis.
24643196 2014 Prolonged calcitonin receptor signaling by salmon, but not human calcitonin, reveals ligand bias.
24522475 2014 Calcitonin receptor gene polymorphism in cCinese Xinjiang Han and Uygur women with primary osteoporosis.
24296906 2014 Genetic polymorphisms in calcitonin receptor gene and risk for recurrent kidney calcium stone disease.
23820954 2013 Profiling of the calcitonin-calcitonin receptor axis in primary prostate cancer: clinical implications and molecular correlates.
23202124 2013 New loci associated with birth weight identify genetic links between intrauterine growth and adult height and metabolism.
23137636 2013 Association between osteoporosis and polymorphisms of the bone Gla protein, estrogen receptor 1, collagen 1-A1 and calcitonin receptor genes in Turkish postmenopausal women.
22946511 2013 Receptor activity-modifying protein-dependent impairment of calcitonin receptor splice variant ?(1-47)hCT((a)) function.
More...