Property Summary

NCBI Gene PubMed Count 125
Grant Count 113
R01 Count 73
Funding $9,415,208.22
PubMed Score 425.12
PubTator Score 603.81

Knowledge Summary

Patent (13,868)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.500 0.003
pituitary cancer -2.400 0.011
psoriasis 2.000 0.000

Synonym

Accession P30968 O75793 Q14D13 Q92644 GnRH receptor
Symbols HH7
GRHR
LRHR
LHRHR
GNRHR1

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (100)

PMID Text
26644469 analysis of information transfer via gonadotropin-releasing hormone receptors to extracellular signal-regulated kinase or nuclear factor of activated T-cells
26308290 Data suggest differences in regulation of expression of PEDF (up-regulation) vs. VEGF (down-regulation) in granulosa cells explain reduced risk of ovarian hyperstimulation syndrome due to ovulation induction using GnRH/GNRHR agonists rather than hCG.
26044071 Results show that biallelic gonadotropin releasing hormone receptor (GNRHR) mutations are not a frequent cause of age-related androgen decline in men.
25592315 A high prevalence of endometriosis, polymorphism in the LHCGR and GnRH1 and progonadoliberin-2 antibodies in serum was found among the patients with severe dysmotility after treatment with GnRH analogs.
25531638 study found a novel mutation in PROK2 in two male siblings presenting normosmic congenital hypogonadotropic hypogonadism, in whom a mutation in the GNRHR gene had been previously described, suggesting the possibility of a digenic inheritance
25293576 GnRH receptors on triple negative breast cancer cells can be used for targeted therapy of these cancers with GnRH agonist triptorelin
25016926 Mutations in GNRHR do not appear to be involved in the pathogenesis of constitutional delay of growth and puberty.
24732674 Mutations were found in the following genes in one or more patients with congenital hypogonadotropic hypogonadism: KAL1, FGFR1, GNRHR, and CHD7
24685158 Interaction between ER-associated Hsp40s and the Vps34 complex permits the selective degradation of ERAD-resistant membrane protein GNRHR via ERQC autophagy.
24472523 GnRH, through heterotopic expression of its receptor, may be a potential regulator of CYP11B2 expression levels in some cases of aldosterone-producing adenoma.
More...

AA Sequence

MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKG      1 - 70
KKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRS     71 - 140
LAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAF    141 - 210
YNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCW    211 - 280
TPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL                          281 - 328
//

Text Mined References (126)

PMID Year Title
26644469 2016 Information Transfer in Gonadotropin-releasing Hormone (GnRH) Signaling: EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK)-MEDIATED FEEDBACK LOOPS CONTROL HORMONE SENSING.
26308290 2015 GnRH Agonist Triggering Modulates PEDF to VEGF Ratio Inversely to hCG in Granulosa Cells.
26044071 2016 Gonadotropin-releasing hormone receptor mutations in ageing men.
25592315 2015 Severe gastrointestinal dysmotility developed after treatment with gonadotropin-releasing hormone analogs.
25531638 2015 Triallelic digenic mutation in the prokineticin 2 and GNRH receptor genes in two brothers with normosmic congenital hypogonadotropic hypogonadism.
25293576 2015 Receptors for luteinizing hormone-releasing hormone (GnRH) as therapeutic targets in triple negative breast cancers (TNBC).
25077900 2014 The prevalence of CHD7 missense versus truncating mutations is higher in patients with Kallmann syndrome than in typical CHARGE patients.
25016926 2014 Role of gonadotropin-releasing hormone receptor mutations in patients with a wide spectrum of pubertal delay.
24732674 2014 Genetics of congenital hypogonadotropic hypogonadism in Denmark.
24685158 2014 Quality control autophagy degrades soluble ERAD-resistant conformers of the misfolded membrane protein GnRHR.
More...