Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00

Knowledge Summary

Patent (396)


  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.76219959716821E-5


Accession P30954 Q2M1M8 Q5VSV1 Q6IET5 Q96R56
Symbols HGMP07J


  Ortholog (1)

Species Source
Rat EggNOG Inparanoid

AA Sequence

DQLISVTYTVITPLLNPVVYTLRNKEVKDALCRAVGGKFS                                  281 - 320

Text Mined References (11)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22939635 2012 Genome-wide association and population genetic analysis of C-reactive protein in African American and Hispanic American women.
20237162 2010 Chemerin, a novel adipokine in the regulation of angiogenesis.
17903294 2007 Genome-wide association and linkage analyses of hemostatic factors and hematological phenotypes in the Framingham Heart Study.
17903293 2007 Genome-wide association with select biomarker traits in the Framingham Heart Study.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.