Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00

Knowledge Summary

Patent (396)

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.8e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 0.9

AA Sequence

MLLCFRFGNQSMKRENFTLITDFVFQGFSSFHEQQITLFGVFLALYILTLAGNIIIVTIIRMDLHLHTPM      1 - 70
YFFLSMLSTSETVYTLVILPRMLSSLVGMSQPISLAGCATQMFFFVTFGITNCFLLTAMGYDRYVAICNP     71 - 140
LRYMVIMNKRLRIQLVLGACSIGLIVAITQVTSVFRLPFCARKVPHFFCDIRPVMKLSCIDTTVNEILTL    141 - 210
IISVLVLVVPMGLVFISYVLIISTILKIASVEGRKKAFATCASHLTVVIVHYSCASIAYLKPKSENTREH    211 - 280
DQLISVTYTVITPLLNPVVYTLRNKEVKDALCRAVGGKFS                                  281 - 320
//

Text Mined References (11)

PMID Year Title