Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.10
PubTator Score 1.10

Knowledge Summary

Patent (5,973)

Expression

Synonym

Accession P30953 O43884 P47882 P47885 Q6IFA9 Q6IFM5 Q9UBJ1 Q9UM60
Symbols OR1E5
OR1E6
HGM071
OR17-2
OR1E8P
OR1E9P
OST547
OR13-66
OR17-32

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMYLFLSNLSFSD      1 - 70
LCFSSVTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAYDRYVAICFPLHYTAIMSPML     71 - 140
CLALVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCDMSALLKLAFSDTRVNEWVIFIMGGLILVIP    141 - 210
FLLILGSYARIVSSILKVPSSKGICKAFSTCGSHLSVVSLFYGTVIGLYLCSSANSSTLKDTVMAMMYTV    211 - 280
VTPMLNPFIYSLRNRDMKGALSRVIHQKKTFFSL                                        281 - 314
//

Text Mined References (8)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
10706615 2000 The olfactory receptor gene repertoire in primates and mouse: evidence for reduction of the functional fraction in primates.
10673334 2000 Sequence, structure, and evolution of a complete human olfactory receptor gene cluster.
9500546 1998 Distribution of olfactory receptor genes in the human genome.
8004088 1994 Olfactory receptor gene cluster on human chromosome 17: possible duplication of an ancestral receptor repertoire.
1370859 1992 Expression of members of the putative olfactory receptor gene family in mammalian germ cells.