Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.10
PubTator Score 1.10

Knowledge Summary

Patent (5,973)

Expression

Synonym

Accession P30953 O43884 P47882 P47885 Q6IFA9 Q6IFM5 Q9UBJ1 Q9UM60
Symbols OR1E5
OR1E6
HGM071
OR17-2
OR1E8P
OR1E9P
OST547
OR13-66
OR17-32

Gene

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMYLFLSNLSFSD      1 - 70
LCFSSVTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAYDRYVAICFPLHYTAIMSPML     71 - 140
CLALVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCDMSALLKLAFSDTRVNEWVIFIMGGLILVIP    141 - 210
FLLILGSYARIVSSILKVPSSKGICKAFSTCGSHLSVVSLFYGTVIGLYLCSSANSSTLKDTVMAMMYTV    211 - 280
VTPMLNPFIYSLRNRDMKGALSRVIHQKKTFFSL                                        281 - 314
//

Text Mined References (8)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
10706615 2000 The olfactory receptor gene repertoire in primates and mouse: evidence for reduction of the functional fraction in primates.
10673334 2000 Sequence, structure, and evolution of a complete human olfactory receptor gene cluster.
9500546 1998 Distribution of olfactory receptor genes in the human genome.
8004088 1994 Olfactory receptor gene cluster on human chromosome 17: possible duplication of an ancestral receptor repertoire.
1370859 1992 Expression of members of the putative olfactory receptor gene family in mammalian germ cells.