Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.09
PubTator Score 1.10

Knowledge Summary

Patent (5,973)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Gene RIF (1)

AA Sequence

MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMYLFLSNLSFSD      1 - 70
LCFSSVTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAYDRYVAICFPLHYTAIMSPML     71 - 140
CLALVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCDMSALLKLAFSDTRVNEWVIFIMGGLILVIP    141 - 210
FLLILGSYARIVSSILKVPSSKGICKAFSTCGSHLSVVSLFYGTVIGLYLCSSANSSTLKDTVMAMMYTV    211 - 280
VTPMLNPFIYSLRNRDMKGALSRVIHQKKTFFSL                                        281 - 314
//

Text Mined References (8)

PMID Year Title