Property Summary

NCBI Gene PubMed Count 20
Grant Count 48
R01 Count 33
Funding $4,793,064.18
PubMed Score 233.44
PubTator Score 18.08

Knowledge Summary

Patent (28,763)

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma -1.400 0.000

 GWAS Trait (1)

Gene RIF (6)

PMID Text
21457069 5-HT6 show no striking effects on executive function in the Chinese Han population.
19455600 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
16856120 Observational study of gene-disease association. (HuGE Navigator)
12627464 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANYLICSLAVTDF      1 - 70
LVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALDRYRAITDAVEYARKRTPKHA     71 - 140
GIMITIVWIISVFISMPPLFWRHQGTSRDDECIIKHDHIVSTIYSTFGAFYIPLALILILYYKIYRAAKT    141 - 210
LYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRR    211 - 280
QKISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCDKCKISEEMSNFLAWLGYLNSLINPLIYTIF    281 - 350
NEDFKKAFQKLVRCRC                                                          351 - 366
//

Text Mined References (23)

PMID Year Title
21457069 2011 Association analysis of TPH2, 5-HT2A, and 5-HT6 with executive function in a young Chinese Han population.
21422162 2011 Toward selective drug development for the human 5-hydroxytryptamine 1E receptor: a comparison of 5-hydroxytryptamine 1E and 1F receptor structure-affinity relationships.
20945968 2011 Serotonin receptors - from molecular biology to clinical applications.
19455600 2010 Association study of the serotoninergic system in migraine in the Spanish population.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18476671 2008 Serotonin receptors.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
16856120 2006 Association study of seven polymorphisms in four serotonin receptor genes on suicide victims.
More...