Property Summary

NCBI Gene PubMed Count 20
PubMed Score 233.44
PubTator Score 18.08

Knowledge Summary

Patent (28,763)

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma -1.400 0.000

Synonym

Accession P30939 5-HT-1F
Symbols 5HT6
MR77
5-HT1F
HTR1EL
5-HT-1F

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

  TechDev Info (1)

 GWAS Trait (1)

Gene RIF (6)

PMID Text
21457069 5-HT6 show no striking effects on executive function in the Chinese Han population.
19455600 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
16856120 Observational study of gene-disease association. (HuGE Navigator)
12627464 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANYLICSLAVTDF      1 - 70
LVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALDRYRAITDAVEYARKRTPKHA     71 - 140
GIMITIVWIISVFISMPPLFWRHQGTSRDDECIIKHDHIVSTIYSTFGAFYIPLALILILYYKIYRAAKT    141 - 210
LYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRR    211 - 280
QKISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCDKCKISEEMSNFLAWLGYLNSLINPLIYTIF    281 - 350
NEDFKKAFQKLVRCRC                                                          351 - 366
//

Text Mined References (23)

PMID Year Title
21457069 2011 Association analysis of TPH2, 5-HT2A, and 5-HT6 with executive function in a young Chinese Han population.
21422162 2011 Toward selective drug development for the human 5-hydroxytryptamine 1E receptor: a comparison of 5-hydroxytryptamine 1E and 1F receptor structure-affinity relationships.
20945968 2011 Serotonin receptors - from molecular biology to clinical applications.
19455600 2010 Association study of the serotoninergic system in migraine in the Spanish population.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18476671 2008 Serotonin receptors.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
16856120 2006 Association study of seven polymorphisms in four serotonin receptor genes on suicide victims.
More...