Property Summary

NCBI Gene PubMed Count 115
PubMed Score 32.17
PubTator Score 37.43

Knowledge Summary

Patent (1,209)

Expression

Synonym

Gene

PDB

2ASG  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Xenopus OMA EggNOG

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen

Gene RIF (93)

PMID Text
26942719 two SNPs (rs6495308 and rs11072768) in CHRNA5-A3-B4 have a indirect effect on lung cancer through smoking behaviors
26689306 Our data suggest that gene variance in the CHRNA5-CHRNA3-CHRNB4 cluster is associated with an increased risk of death, incidence of COPD and tobacco-related cancer in smokers.
26010901 Data suggest that CHRNA5-A3-B4 gene variants do not exhibit a robust association with smoking cessation and are unlikely to be useful for clinically optimizing smoking cessation pharmacotherapy for Caucasian smokers.
25891420 Identified a novel exon variant Ser140Gly of CHRNB4 , and validated two previously reported variants Tyr215Tyr and Asp398Asn are significantly associated with COPD risk in Chinese.
25474695 CHRNA5-A3-B4 genotype associates with body mass index in never smokers.
25384568 Study provides new evidence that the overexpression of the CHRNA5/A3/B4 region disrupts pyramidal neuronal structure in the hippocampus, and thus affecting the cognitive capacities
25297392 Suggest no relationship between these smoking-related SNPs in the CHRNA5/A3/B4 gene cluster and psoriasis vulgaris in Chinese Han population.
25293386 In Mendelian randomisation analyses, there was no strong evidence that the minor allele of rs16969968/rs1051730 was associated with depression, anxiety or psychological distress in current or former smokers. [Meta-analysis]
25172267 Unmethylation of the CHRNB4 gene is an unfavorable prognostic factor in non-small cell lung cancer.
24804708 We identified 10 low frequency non-synonymous variants in CHRNB4, and found a highly significant correlation between carrier status weighted by either ACh EC50 or by low response to nicotine.
More...

AA Sequence

MRRAPSLVLFFLVALCGRGNCRVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIKLQLSLAQLISVNE      1 - 70
REQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNNADGTYEVSVYTNLIVRSNGS     71 - 140
VLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYDHTEIDMVLMTPTASMDDFTPSGEWDIVALPGRR    141 - 210
TVNPQDPSYVDVTYDFIIKRKPLFYTINLIIPCVLTTLLAILVFYLPSDCGEKMTLCISVLLALTFFLLL    211 - 280
ISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVKRCFLHKLPTFLFMKRP    281 - 350
GPDSSPARAFPPSKSCVTKPEATATSTSPSNFYGNSMYFVNPASAASKSPAGSTPVAIPRDFWLRSSGRF    351 - 420
RQDVQEALEGVSFIAQHMKNDDEDQSVVEDWKYVAMVVDRLFLWVFMFVCVLGTVGLFLPPLFQTHAASE    421 - 490
GPYAAQRD                                                                  491 - 498
//

Text Mined References (117)

PMID Year Title
26942719 2016 Chromosome 15q25 (CHRNA3-CHRNB4) Variation Indirectly Impacts Lung Cancer Risk in Chinese Males.
26689306 2016 Gene variance in the nicotinic receptor cluster (CHRNA5-CHRNA3-CHRNB4) predicts death from cardiopulmonary disease and cancer in smokers.
26010901 2015 Lack of Associations of CHRNA5-A3-B4 Genetic Variants with Smoking Cessation Treatment Outcomes in Caucasian Smokers despite Associations with Baseline Smoking.
25891420 2015 Exon sequencing identifies a novel CHRNA3-CHRNA5-CHRNB4 variant that increases the risk for chronic obstructive pulmonary disease.
25474695 2014 Stratification by smoking status reveals an association of CHRNA5-A3-B4 genotype with body mass index in never smokers.
25384568 2014 Hippocampal changes produced by overexpression of the human CHRNA5/A3/B4 gene cluster may underlie cognitive deficits rescued by nicotine in transgenic mice.
25297392 2014 An association study on the CHRNA5/A3/B4 gene cluster, smoking and psoriasis vulgaris.
25293386 2014 Investigating the possible causal association of smoking with depression and anxiety using Mendelian randomisation meta-analysis: the CARTA consortium.
25172267 2014 Unmethylation of the CHRNB4 gene is an unfavorable prognostic factor in non-small cell lung cancer.
25072098 2014 Beyond cigarettes per day. A genome-wide association study of the biomarker carbon monoxide.
More...