Property Summary

NCBI Gene PubMed Count 115
Grant Count 33
R01 Count 22
Funding $2,723,909.36
PubMed Score 32.17
PubTator Score 37.43

Knowledge Summary

Patent (1,209)

Expression

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen

Gene RIF (93)

PMID Text
26942719 two SNPs (rs6495308 and rs11072768) in CHRNA5-A3-B4 have a indirect effect on lung cancer through smoking behaviors
26689306 Our data suggest that gene variance in the CHRNA5-CHRNA3-CHRNB4 cluster is associated with an increased risk of death, incidence of COPD and tobacco-related cancer in smokers.
26010901 Data suggest that CHRNA5-A3-B4 gene variants do not exhibit a robust association with smoking cessation and are unlikely to be useful for clinically optimizing smoking cessation pharmacotherapy for Caucasian smokers.
25891420 Identified a novel exon variant Ser140Gly of CHRNB4 , and validated two previously reported variants Tyr215Tyr and Asp398Asn are significantly associated with COPD risk in Chinese.
25474695 CHRNA5-A3-B4 genotype associates with body mass index in never smokers.
25384568 Study provides new evidence that the overexpression of the CHRNA5/A3/B4 region disrupts pyramidal neuronal structure in the hippocampus, and thus affecting the cognitive capacities
25297392 Suggest no relationship between these smoking-related SNPs in the CHRNA5/A3/B4 gene cluster and psoriasis vulgaris in Chinese Han population.
25293386 In Mendelian randomisation analyses, there was no strong evidence that the minor allele of rs16969968/rs1051730 was associated with depression, anxiety or psychological distress in current or former smokers. [Meta-analysis]
25172267 Unmethylation of the CHRNB4 gene is an unfavorable prognostic factor in non-small cell lung cancer.
24804708 We identified 10 low frequency non-synonymous variants in CHRNB4, and found a highly significant correlation between carrier status weighted by either ACh EC50 or by low response to nicotine.
More...

AA Sequence

MRRAPSLVLFFLVALCGRGNCRVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIKLQLSLAQLISVNE      1 - 70
REQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNNADGTYEVSVYTNLIVRSNGS     71 - 140
VLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYDHTEIDMVLMTPTASMDDFTPSGEWDIVALPGRR    141 - 210
TVNPQDPSYVDVTYDFIIKRKPLFYTINLIIPCVLTTLLAILVFYLPSDCGEKMTLCISVLLALTFFLLL    211 - 280
ISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVKRCFLHKLPTFLFMKRP    281 - 350
GPDSSPARAFPPSKSCVTKPEATATSTSPSNFYGNSMYFVNPASAASKSPAGSTPVAIPRDFWLRSSGRF    351 - 420
RQDVQEALEGVSFIAQHMKNDDEDQSVVEDWKYVAMVVDRLFLWVFMFVCVLGTVGLFLPPLFQTHAASE    421 - 490
GPYAAQRD                                                                  491 - 498
//

Text Mined References (117)

PMID Year Title
26942719 2016 Chromosome 15q25 (CHRNA3-CHRNB4) Variation Indirectly Impacts Lung Cancer Risk in Chinese Males.
26689306 2016 Gene variance in the nicotinic receptor cluster (CHRNA5-CHRNA3-CHRNB4) predicts death from cardiopulmonary disease and cancer in smokers.
26010901 2015 Lack of Associations of CHRNA5-A3-B4 Genetic Variants with Smoking Cessation Treatment Outcomes in Caucasian Smokers despite Associations with Baseline Smoking.
25891420 2015 Exon sequencing identifies a novel CHRNA3-CHRNA5-CHRNB4 variant that increases the risk for chronic obstructive pulmonary disease.
25474695 2014 Stratification by smoking status reveals an association of CHRNA5-A3-B4 genotype with body mass index in never smokers.
25384568 2014 Hippocampal changes produced by overexpression of the human CHRNA5/A3/B4 gene cluster may underlie cognitive deficits rescued by nicotine in transgenic mice.
25297392 2014 An association study on the CHRNA5/A3/B4 gene cluster, smoking and psoriasis vulgaris.
25293386 2014 Investigating the possible causal association of smoking with depression and anxiety using Mendelian randomisation meta-analysis: the CARTA consortium.
25172267 2014 Unmethylation of the CHRNB4 gene is an unfavorable prognostic factor in non-small cell lung cancer.
25072098 2014 Beyond cigarettes per day. A genome-wide association study of the biomarker carbon monoxide.
More...