Property Summary

NCBI Gene PubMed Count 158
Grant Count 59
R01 Count 43
Funding $6,897,912.13
PubMed Score 341.82
PubTator Score 316.74

Knowledge Summary

Patent (19,632)

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 3.000 0.000
cutaneous lupus erythematosus 1.200 0.007
glioblastoma -2.700 0.000
osteosarcoma 1.583 0.000
ependymoma -1.900 0.000
group 3 medulloblastoma 2.500 0.002
atypical teratoid / rhabdoid tumor -2.500 0.000
medulloblastoma, large-cell 1.800 0.004
pediatric high grade glioma -1.900 0.000
pilocytic astrocytoma -2.100 0.000
subependymal giant cell astrocytoma -1.658 0.001
ovarian cancer -1.400 0.000

Synonym

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (133)

PMID Text
26978232 The number of SSTR-2-expressing cells was significantly smaller in the patients with Crohn's disease than that in those with the unchanged mucosa and in those with indeterminate (unclassified) colitis.
26796520 SSTR2 promoter hypermethylation might be associated with the risk and progression of laryngeal squamous cell carcinoma in males.
26733502 Filamin-A is required to mediate SSTR2 effects in pancreatic neuroendocrine tumours
26474434 Data showed that the distribution of somatostatin receptor (SSTR) subtypes among the 199 pancreatic neuroendocrine tumors (PNETs) was: SSTR2 (54.8%), SSTR1 (53.3%), SSTR4 (51.8%), SSTR5 (33.7%), and SSTR3 (28.6%).
26391562 Results show that histological subtyping of pituitary tumor correlated with SSTR2, E cadherin and p27kip protein levels and these may serve as useful biomarkers for prognosis.
26339384 CD56 marker is a useful alternative that is comparable to SSTR2A for the diagnosis of phosphaturic mesenchymal tumors.
26259237 there is an elevation in CXCR4 and a decrease in SSTR2A expression with increasing malignancy in gastroenteropancreatic neuroendocrine neoplasms
26238605 SSTR2 gene expression was dysregulated in the anterior cingulate of bipolar patients.
26211366 VPA was observed to stimulate the expression of somatostatin receptor type 2 (SSTR2).
26158180 The expression of VEGF and SSTR2 were associated with progression and prognosis of gastric cancer.
More...

AA Sequence

MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILR      1 - 70
YAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDR     71 - 140
YLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFII    141 - 210
YTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSV    211 - 280
SMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRL    281 - 350
NETTETQRTLLNGDLQTSI                                                       351 - 369
//

Text Mined References (158)

PMID Year Title
26978232 [Somatostatin receptor expression in the ileal mucosa of patients with inflammatory bowel disease].
26796520 2016 SSTR2 promoter hypermethylation is associated with the risk and progression of laryngeal squamous cell carcinoma in males.
26733502 2016 Filamin-A is required to mediate SST2 effects in pancreatic neuroendocrine tumours.
26474434 2016 Prognostic Value of Somatostatin Receptor Subtypes in Pancreatic Neuroendocrine Tumors.
26391562 2015 Differential somatostatin receptor (SSTR) 1-5 expression and downstream effectors in histologic subtypes of growth hormone pituitary tumors.
26339384 2015 CD56 may be a more useful immunohistochemical marker than somatostatin receptor 2A for the diagnosis of phosphaturic mesenchymal tumors.
26259237 2015 Inverse expression of somatostatin and CXCR4 chemokine receptors in gastroenteropancreatic neuroendocrine neoplasms of different malignancy.
26238605 2015 Transcriptome sequencing of the anterior cingulate in bipolar disorder: dysregulation of G protein-coupled receptors.
26211366 2016 Valproic acid induces NET cell growth arrest and enhances tumor suppression of the receptor-targeted peptide-drug conjugate via activating somatostatin receptor type II.
26158180 2014 Correlation between Vascular Endothelial Growth Factor and Somatostatin Receptor with Progression and Prognosis in Gastric Cancer.
More...