Property Summary

Ligand Count 214
NCBI Gene PubMed Count 163
PubMed Score 363.48
PubTator Score 316.74

Knowledge Summary

Patent (19,632)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.400 1.7e-02
Astrocytoma, Pilocytic -2.000 1.1e-06
atypical teratoid / rhabdoid tumor -2.500 4.5e-08
cutaneous lupus erythematosus 1.200 6.8e-03
ependymoma -1.900 2.5e-11
glioblastoma -1.700 1.5e-05
group 3 medulloblastoma 2.500 1.5e-03
malignant mesothelioma 3.000 3.4e-07
medulloblastoma, large-cell 1.800 3.8e-03
osteosarcoma 1.583 3.3e-04
ovarian cancer -1.400 8.0e-07
subependymal giant cell astrocytoma -1.644 4.2e-02

Gene RIF (138)

AA Sequence

MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILR      1 - 70
YAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDR     71 - 140
YLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFII    141 - 210
YTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSV    211 - 280
SMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRL    281 - 350
NETTETQRTLLNGDLQTSI                                                       351 - 369
//

Text Mined References (163)

PMID Year Title