Property Summary

NCBI Gene PubMed Count 59
PubMed Score 126.29
PubTator Score 105.55

Knowledge Summary

Patent (8,420)


  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 3.26761085703177E-31
non-small cell lung cancer 2798 4.58127328521977E-18
astrocytoma 1493 5.585265687331E-18
ovarian cancer 8492 6.86979279099812E-15
oligodendroglioma 2849 8.48048782972214E-12
lung carcinoma 2844 9.98008861171384E-9
medulloblastoma 1524 1.10366280877146E-8
lung adenocarcinoma 2714 4.10483216438323E-8
cystic fibrosis 1670 1.98752911929225E-7
atypical teratoid / rhabdoid tumor 4369 6.35372886747475E-7
glioblastoma 5572 5.01217507181903E-6
osteosarcoma 7933 6.11749444764456E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 8.31620195089778E-5
medulloblastoma, large-cell 6234 1.283349013915E-4
interstitial cystitis 2299 4.95543477052653E-4
adult high grade glioma 2148 0.00147864423210644
ulcerative colitis 2087 0.0015199013499154
Pick disease 1893 0.00161015503694788
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00415972727535933
primitive neuroectodermal tumor 3031 0.00541282046833976
lung cancer 4473 0.00774310611284518
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0192078581450421


  Differential Expression (22)

Disease log2 FC p
astrocytoma -2.400 0.000
glioblastoma -4.300 0.000
oligodendroglioma -2.200 0.000
osteosarcoma -1.260 0.000
medulloblastoma -4.500 0.000
cystic fibrosis 3.586 0.000
atypical teratoid / rhabdoid tumor -4.100 0.000
medulloblastoma, large-cell -4.700 0.000
primitive neuroectodermal tumor -3.100 0.005
non-small cell lung cancer -2.050 0.000
intraductal papillary-mucinous adenoma (... 3.600 0.000
intraductal papillary-mucinous carcinoma... 3.100 0.004
intraductal papillary-mucinous neoplasm ... 2.300 0.019
lung cancer 1.200 0.008
interstitial cystitis -2.400 0.000
adult high grade glioma -3.500 0.001
lung adenocarcinoma -1.300 0.000
lung carcinoma 1.100 0.000
Pick disease -1.200 0.002
ulcerative colitis -1.500 0.002
ovarian cancer -2.300 0.000
psoriasis -1.100 0.000


Accession P30872 SS-1-R
Symbols SS1R


PANTHER Protein Class (2)

  Ortholog (9)

  TechDev Info (1)

Gene RIF (40)

26474434 Data showed that the distribution of somatostatin receptor (SSTR) subtypes among the 199 pancreatic neuroendocrine tumors (PNETs) was: SSTR2 (54.8%), SSTR1 (53.3%), SSTR4 (51.8%), SSTR5 (33.7%), and SSTR3 (28.6%).
25962406 An immunohistochemical investigation of the expression of somatostatin receptor subtypes
25734919 Aberrant methylation inactivates somatostatin and SSTR1 in head and neck squamous cell carcinoma.
24742330 SSTR-PET showed high sensitivity for imaging bone, soft tissue and brain metastases, and particularly in combination with CT had a significant impact on clinical stage and patient management.
24634938 Tumor cells in the tissue samples of the patients diagnosed with advanced-stage hepatocellular carcinoma expressed a high proportion of SSTR1 and SSTR5.
24512486 SSTRs are overexpressed in primary pigmented nodular adrenocortical disease tissues in comparison with normal adrenal cortex
24106690 Somatostatin receptor imaging (SRI) using SPECT or PET as a whole-body imaging technique has become a crucial part of the management of Neuroendocrine tumors
23722468 Somatostatin receptor 1 is a novel methylated gene driven by EBV infection in gastric cancer cells and acts as a potential tumour suppressor.
23466804 The UMB-7 may prove of great value in the identification of sst1-expressing tumors during routine histopathological examinations. This may open up new routes for diagnostic and therapeutic intervention.
23455179 Activated/phosphorylated pMAPK 44/42 was detected in 82% of medulloblastomas, all subtypes, and in 62.5% of primitive neuroectodermal tumors with coexpression of SSR1 in one third.

AA Sequence

VDYYATALKSRAYSVEDFQPENLESGGVFRNGTCTSRITTL                                 351 - 391

Text Mined References (59)

PMID Year Title
26474434 2016 Prognostic Value of Somatostatin Receptor Subtypes in Pancreatic Neuroendocrine Tumors.
25962406 2015 An immunohistochemical investigation of the expression of somatostatin receptor subtypes - should therapeutic trials be performed to determine the efficacy of somatostatin analogs in treating advanced thyroid malignances?
25734919 2015 Aberrant methylation inactivates somatostatin and somatostatin receptor type 1 in head and neck squamous cell carcinoma.
24742330 2014 Somatostatin receptor expression in Merkel cell carcinoma as target for molecular imaging.
24634938 2013 Somatostatin receptor 1 (SSTR1) and somatostatin receptor 5 (SSTR5)expression in hepatocellular carcinoma.
24512486 2014 Does somatostatin have a role in the regulation of cortisol secretion in primary pigmented nodular adrenocortical disease (ppnad)? a clinical and in vitro investigation.
24106690 2013 Somatostatin receptor-based molecular imaging and therapy for neuroendocrine tumors.
23722468 2013 Somatostatin receptor 1, a novel EBV-associated CpG hypermethylated gene, contributes to the pathogenesis of EBV-associated gastric cancer.
23466804 2013 Reevaluation of sst? somatostatin receptor expression in human normal and neoplastic tissues using the novel rabbit monoclonal antibody UMB-7.
23455179 2013 Differential expression of somatostatin receptors, P44/42 MAPK, and mTOR activation in medulloblastomas and primitive neuroectodermal tumors.