Property Summary

Ligand Count 1
NCBI Gene PubMed Count 89
PubMed Score 227.49
PubTator Score 224.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer -3.800 2.2e-02
colon cancer -1.500 5.2e-06
interstitial cystitis 2.500 5.6e-03
lung cancer -2.300 5.3e-05
mucosa-associated lymphoid tissue lympho... 1.516 1.8e-02
osteosarcoma -3.598 6.1e-04
psoriasis -1.100 7.3e-04

 GWAS Trait (1)

Gene RIF (72)

AA Sequence

MNVRIFYSVSQSPHSLLSLLFYCAILESRISATMPLFKLPAEEKQIDDAMRNFAEKVFASEVKDEGGRQE      1 - 70
ISPFDVDEICPISHHEMQAHIFHLETLSTSTEARRKKRFQGRKTVNLSIPLSETSSTKLSHIDEYISSSP     71 - 140
TYQTVPDFQRVQITGDYASGVTVEDFEIVCKGLYRALCIREKYMQKSFQRFPKTPSKYLRNIDGEAWVAN    141 - 210
ESFYPVFTPPVKKGEDPFRTDNLPENLGYHLKMKDGVVYVYPNEAAVSKDEPKPLPYPNLDTFLDDMNFL    211 - 280
LALIAQGPVKTYTHRRLKFLSSKFQVHQMLNEMDELKELKNNPHRDFYNCRKVDTHIHAAACMNQKHLLR    281 - 350
FIKKSYQIDADRVVYSTKEKNLTLKELFAKLKMHPYDLTVDSLDVHAGRQTFQRFDKFNDKYNPVGASEL    351 - 420
RDLYLKTDNYINGEYFATIIKEVGADLVEAKYQHAEPRLSIYGRSPDEWSKLSSWFVCNRIHCPNMTWMI    421 - 490
QVPRIYDVFRSKNFLPHFGKMLENIFMPVFEATINPQADPELSVFLKHITGFDSVDDESKHSGHMFSSKS    491 - 560
PKPQEWTLEKNPSYTYYAYYMYANIMVLNSLRKERGMNTFLFRPHCGEAGALTHLMTAFMIADDISHGLN    561 - 630
LKKSPVLQYLFFLAQIPIAMSPLSNNSLFLEYAKNPFLDFLQKGLMISLSTDDPMQFHFTKEPLMEEYAI    631 - 700
AAQVFKLSTCDMCEVARNSVLQCGISHEEKVKFLGDNYLEEGPAGNDIRRTNVAQIRMAYRYETWCYELN    701 - 770
LIAEGLKSTE                                                                771 - 780
//

Text Mined References (90)

PMID Year Title