Property Summary

NCBI Gene PubMed Count 55
Grant Count 31
R01 Count 19
Funding $3,894,018.87
PubMed Score 137.78
PubTator Score 117.01

Knowledge Summary


No data available


Protein-protein Interaction (9)

Gene RIF (30)

26751691 ALDH3A1 has a role in the maintenance of corneal epithelial homeostasis by simultaneously modulating proliferation and differentiation through both enzymatic and non-enzymatic mechanisms
26124079 Down-regulation of ALDH3 activity in trophoblast stem cells initiates trophoblast differentiation during placental development.
25221425 Reported increased expression of ALDH3A1, PDIA3, and PRDX2 in pterygia using a proteomic approach. These proteins are presumed to have a protective role against oxidative stress-induced apoptosis.
24762960 While ALDH3A1 was not found in prostate glands, it was present in prostatic intraepithelial neoplasia, further increased in carcinomas, and upregulated in lymphatic metastases. ALDH3A1 increased in DU145-cell-derived lung metastasis vs. local xenografts.
24316006 SiRNA-mediated suppression of ALDH3A1 blocked ALDH enzymatic activity and augmented cytotoxicity in CSE-exposed cells.
24276407 No correlation between ALDH3A1 expression and patient survival or tumour recurrence was observed.In conclusion, ALDH3A1 is a marker of activation of the Wnt/ss-catenin pathway in hepatocellular carcinoma
22406320 ALDH3A1 provides exceptional protection from the adverse effects of pathophysiological concentrations of 4-HNE such as may occur during periods of oxidative stress
21251908 through modulation of PPARgamma or ALDH3A1, it may be possible to reduce cell proliferation in tumor cells or stimulate cell proliferation in normal cells during tissue regeneration.
21229876 Antihypertensives, nonopioid analgesics and hormonal contraceptives significantly affect the salivary ALDH3A1 activity.
21203538 the UV-induced inactivation of ALDH3A1 is a result of non-native aggregation and associated structural changes rather than specific damage to the active site Cys

AA Sequence

TFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH                                         421 - 453

Publication (60)

PMID Year Title
26751691 2016 ALDH3A1 Plays a Functional Role in Maintenance of Corneal Epithelial Homeostasis.
26124079 2015 FBXL12-Mediated Degradation of ALDH3 is Essential for Trophoblast Differentiation During Placental Development.
25221425 2014 Proteomic analysis in pterygium; upregulated protein expression of ALDH3A1, PDIA3, and PRDX2.
24762960 2014 Aldehyde dehydrogenase 3A1 associates with prostate tumorigenesis.
24316006 2014 Aldehyde dehydrogenase 3A1 protects airway epithelial cells from cigarette smoke-induced DNA damage and cytotoxicity.
24276407 2014 ALDH3A1 is overexpressed in a subset of hepatocellular carcinoma characterised by activation of the Wnt/ß-catenin pathway.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22406320 2012 Molecular mechanisms of ALDH3A1-mediated cellular protection against 4-hydroxy-2-nonenal.
22021038 2011 Discovery of a novel class of covalent inhibitor for aldehyde dehydrogenases.