Property Summary

Ligand Count 14
NCBI Gene PubMed Count 59
PubMed Score 141.33
PubTator Score 117.01

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (9)

Gene RIF (34)

AA Sequence

MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELVGALAADLHKNEWNAYYEEVVYVLEE      1 - 70
IEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNLTIQPMVGAIAAGNSVVLKPS     71 - 140
ELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKERFDHILYTGSTGVGKIIMTAAAKHLTPVTLE    141 - 210
LGGKSPCYVDKNCDLDVACRRIAWGKFMNSGQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSR    211 - 280
DYGRIISARHFQRVMGLIEGQKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEE    281 - 350
AIQFINQREKPLALYMFSSNDKVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFE    351 - 420
TFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH                                         421 - 453
//

Text Mined References (64)

PMID Year Title