Property Summary

NCBI Gene PubMed Count 55
PubMed Score 137.78
PubTator Score 117.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
nasopharyngeal carcinoma 1056 8.51924706794871E-9
head and neck cancer and chronic obstructive pulmonary disease 237 2.09864153057424E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 6.32885735888582E-4
non-small cell lung cancer 2798 0.00831418900600027
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0125600755742498
esophageal adenocarcinoma 737 0.0276063147479732
active Crohn's disease 918 0.0409592044776847
interstitial cystitis 2299 0.0441984198235569
Disease Target Count Z-score Confidence
Cancer 2346 3.451 1.7

Expression

Synonym

Accession P30838 A8K828 Q9BT37
Symbols ALDH3
ALDHIII

Gene

PANTHER Protein Class (2)

PDB

3SZA   3SZB   4H80   4L1O   4L2O  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Pig OMA Inparanoid

Gene RIF (30)

PMID Text
26751691 ALDH3A1 has a role in the maintenance of corneal epithelial homeostasis by simultaneously modulating proliferation and differentiation through both enzymatic and non-enzymatic mechanisms
26124079 Down-regulation of ALDH3 activity in trophoblast stem cells initiates trophoblast differentiation during placental development.
25221425 Reported increased expression of ALDH3A1, PDIA3, and PRDX2 in pterygia using a proteomic approach. These proteins are presumed to have a protective role against oxidative stress-induced apoptosis.
24762960 While ALDH3A1 was not found in prostate glands, it was present in prostatic intraepithelial neoplasia, further increased in carcinomas, and upregulated in lymphatic metastases. ALDH3A1 increased in DU145-cell-derived lung metastasis vs. local xenografts.
24316006 SiRNA-mediated suppression of ALDH3A1 blocked ALDH enzymatic activity and augmented cytotoxicity in CSE-exposed cells.
24276407 No correlation between ALDH3A1 expression and patient survival or tumour recurrence was observed.In conclusion, ALDH3A1 is a marker of activation of the Wnt/ss-catenin pathway in hepatocellular carcinoma
22406320 ALDH3A1 provides exceptional protection from the adverse effects of pathophysiological concentrations of 4-HNE such as may occur during periods of oxidative stress
21251908 through modulation of PPARgamma or ALDH3A1, it may be possible to reduce cell proliferation in tumor cells or stimulate cell proliferation in normal cells during tissue regeneration.
21229876 Antihypertensives, nonopioid analgesics and hormonal contraceptives significantly affect the salivary ALDH3A1 activity.
21203538 the UV-induced inactivation of ALDH3A1 is a result of non-native aggregation and associated structural changes rather than specific damage to the active site Cys
More...

AA Sequence

MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELVGALAADLHKNEWNAYYEEVVYVLEE      1 - 70
IEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNLTIQPMVGAIAAGNSVVLKPS     71 - 140
ELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKERFDHILYTGSTGVGKIIMTAAAKHLTPVTLE    141 - 210
LGGKSPCYVDKNCDLDVACRRIAWGKFMNSGQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSR    211 - 280
DYGRIISARHFQRVMGLIEGQKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEE    281 - 350
AIQFINQREKPLALYMFSSNDKVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFE    351 - 420
TFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH                                         421 - 453
//

Text Mined References (60)

PMID Year Title
26751691 2016 ALDH3A1 Plays a Functional Role in Maintenance of Corneal Epithelial Homeostasis.
26124079 2015 FBXL12-Mediated Degradation of ALDH3 is Essential for Trophoblast Differentiation During Placental Development.
25221425 2014 Proteomic analysis in pterygium; upregulated protein expression of ALDH3A1, PDIA3, and PRDX2.
24762960 2014 Aldehyde dehydrogenase 3A1 associates with prostate tumorigenesis.
24316006 2014 Aldehyde dehydrogenase 3A1 protects airway epithelial cells from cigarette smoke-induced DNA damage and cytotoxicity.
24276407 2014 ALDH3A1 is overexpressed in a subset of hepatocellular carcinoma characterised by activation of the Wnt/ß-catenin pathway.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22406320 2012 Molecular mechanisms of ALDH3A1-mediated cellular protection against 4-hydroxy-2-nonenal.
22021038 2011 Discovery of a novel class of covalent inhibitor for aldehyde dehydrogenases.
More...