Property Summary

NCBI Gene PubMed Count 32
Grant Count 14
Funding $531,766.35
PubMed Score 49.32
PubTator Score 22.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -4.400 0.000
osteosarcoma -2.893 0.000
pancreatic ductal adenocarcinoma liver m... -1.484 0.001
lung cancer 2.200 0.000
acute myeloid leukemia -2.000 0.031

 IMPC Term (1)

Protein-protein Interaction (3)

Gene RIF (21)

PMID Text
26566217 ALDH1B1 is expressed at very high levels in human pancreatic cancer, and it contributes to proliferation in these tumor cells.
26366059 High expression of ALDH1A2 and ALDH1B1 mRNA was found to be significantly correlated to worser survival in all NSCLC patients.
25950950 Data show that ALDH1B1 may promote colon cancer tumorigenesis by modulating the Wnt/beta-catenin, Notch and PI3K/Akt signaling pathways.
25413692 ALDH1B1 metabolizes nitroglycerin and all-trans-retinaldehyde. One of the three human polymorphisms, ALDH1B1*2, is catalytically inactive, likely due to poor NAD(+) binding.
25311581 ALDH1B1 SNPs play a role in shaping the alcohol drinking patterns among the Inuit in Greenland.
25047496 Our findings provide clear evidence for both individual and interactive associations of ALDH1b1 and ALDH2 genes with the development of coronary artery disease in Han Chinese.
24953984 ALDH1 is indicative of stemness and is a biomarker marker in colon cancer.
23667679 Telomere lengths in 52 distinct iodine-unstained lesions with reference to both their size and multiplicity, ALDH2 and ADH1B genotypes, and smoking history, were investigated.
23454351 Mitochondrial NAD dependent aldehyde dehydrogenase either from yeast or human replaces yeast cytoplasmic NADP dependent aldehyde dehydrogenase for the aerobic growth of yeast on ethanol.
23247008 Molecular modeling studies examining predicted protein-protein interactions indicated that heterotetramerization between ALDH2 and ALDH1B1 subunits was highly probable and may partially explain a lack of compensation by ALDH1B1 in ALDH2( *)2 individuals.
More...

AA Sequence

MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHVAE      1 - 70
GDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNLLADLVERDRVYLASLETLDNGKPFQESYALDLD     71 - 140
EVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKV    141 - 210
AEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHVDVDKVAFTGSTEVGHLIQKAAGDSNLK    211 - 280
RVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGN    281 - 350
PFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGP    351 - 420
VQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGN    421 - 490
GRELGEDGLKAYTEVKTVTIKVPQKNS                                               491 - 517
//

Publication (36)

PMID Year Title
26566217 2016 Aldehyde Dehydrogenase 1B1 as a Modulator of Pancreatic Adenocarcinoma.
26366059 2015 Distinct prognostic values and potential drug targets of ALDH1 isoenzymes in non-small-cell lung cancer.
25950950 2015 ALDH1B1 Is Crucial for Colon Tumorigenesis by Modulating Wnt/?-Catenin, Notch and PI3K/Akt Signaling Pathways.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25413692 2015 Human ALDH1B1 polymorphisms may affect the metabolism of acetaldehyde and all-trans retinaldehyde--in vitro studies and computational modeling.
25311581 2014 Genetic variation in alcohol metabolizing enzymes among Inuit and its relation to drinking patterns.
25047496 2014 Synergistic association between two alcohol metabolism relevant genes and coronary artery disease among Chinese hypertensive patients.
24953984 2014 The impact of Aldehyde dehydrogenase 1 expression on prognosis for metastatic colon cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23667679 2013 Telomere shortening in the esophagus of Japanese alcoholics: relationships with chromoendoscopic findings, ALDH2 and ADH1B genotypes and smoking history.
More...