Property Summary

NCBI Gene PubMed Count 37
PubMed Score 501.40
PubTator Score 478.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
aldosterone-producing adenoma 1.495 3.9e-02
astrocytoma 1.800 1.3e-02
Atopic dermatitis 1.100 4.9e-05
atypical teratoid / rhabdoid tumor 1.200 1.4e-03
glioblastoma 1.100 9.5e-03
group 3 medulloblastoma -1.100 2.4e-04
juvenile dermatomyositis 1.323 1.5e-09
lung cancer 2.700 6.4e-05
medulloblastoma, large-cell 1.400 5.2e-04
non diabetic and post-ischemic heart fai... -1.700 9.9e-03
non-small cell lung cancer 1.070 5.6e-13
oligodendroglioma 1.300 1.3e-02
osteosarcoma -2.393 2.1e-06
ovarian cancer 2.400 3.8e-07
pancreatic cancer 1.200 1.1e-03
pancreatic carcinoma 1.200 1.1e-03
pancreatic ductal adenocarcinoma liver m... 1.819 5.9e-03
Pick disease 1.200 6.9e-05
psoriasis 1.600 8.8e-09
tuberculosis -1.200 2.7e-06
ulcerative colitis 1.100 3.5e-06
uncontrolled asthma 1.100 4.0e-03

 GWAS Trait (1)

Gene RIF (25)

AA Sequence

MGCKVLLNIGQQMLRRKVVDCSREETRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISF      1 - 70
LIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFDELI     71 - 140
GRPIGEFSRTHMTLNAPGVLAENPDIFAVIIILILTGLLTLGVKESAMVNKIFTCINVLVLGFIMVSGFV    141 - 210
KGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVK    211 - 280
NPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLDNNSPLPDAFKHVGWEGAKYAVAVGSLCALSAS    281 - 350
LLGSMFPMPRVIYAMAEDGLLFKFLANVNDRTKTPIIATLASGAVAAVMAFLFDLKDLVDLMSIGTLLAY    351 - 420
SLVAACVLVLRYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSK    421 - 490
ISGLIVNISTSLIAVLIITFCIVTVLGREALTKGALWAVFLLAGSALLCAVVTGVIWRQPESKTKLSFKV    491 - 560
PFLPVLPILSIFVNVYLMMQLDQGTWVRFAVWMLIGFIIYFGYGLWHSEEASLDADQARTPDGNLDQCK     561 - 629
//

Text Mined References (38)

PMID Year Title