Property Summary

NCBI Gene PubMed Count 37
Grant Count 191
R01 Count 129
Funding $25,903,370.66
PubMed Score 466.71
PubTator Score 478.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
pancreatic cancer 1.200 0.001
oligodendroglioma 1.300 0.013
uncontrolled asthma 1.100 0.004
psoriasis -2.100 0.000
osteosarcoma -2.393 0.000
astrocytoma 1.800 0.013
non diabetic and post-ischemic heart fai... -1.700 0.010
atypical teratoid / rhabdoid tumor 1.200 0.001
glioblastoma 1.100 0.010
medulloblastoma -1.100 0.000
medulloblastoma, large-cell 1.400 0.001
juvenile dermatomyositis 1.323 0.000
Atopic dermatitis 1.100 0.000
tuberculosis -1.200 0.000
pancreatic ductal adenocarcinoma liver m... 1.819 0.006
non-small cell lung cancer 1.374 0.000
lung cancer 3.800 0.000
pancreatic carcinoma 1.200 0.001
aldosterone-producing adenoma 1.495 0.039
Pick disease 1.200 0.000
ulcerative colitis 1.100 0.000
ovarian cancer 2.400 0.000

Synonym

Accession P30825 Q5JR50 CAT-1
Symbols ERR
ATRC1
CAT-1
HCAT1
REC1L

Gene

PANTHER Protein Class (2)

Gene RIF (24)

PMID Text
26062636 Estradiol increases arginine transport and CAT-1 activity through modulation of constitutive signaling transduction pathways involving ERK. Progesterone inhibits arginine transport and CAT-1 via both PKCalpha and ERK1/2 phosphorylation.
24040099 Overexpression of arginine transporter CAT-1 is associated with accumulation of L-arginine and cell growth in human colorectal cancer tissue.
23841815 The rs41318021 polymorphism in the SLC7A1 gene was not associated with essential hypertension in 50-year-old subjects.
23009292 mRNA levels for high-affinity CAT-1, expressed as a percentage of the wild-type value, are increased by an average 12% and 32% in mdx and transgenic mdx:utr mice respectively.
22870827 CAT1, CAT2, and CAT3 localized in adult brains but with uneven distribution.
22705145 The data demonstrates that CAT1 significantly (but most likely not exclusively) contributes to the cellular uptake of asymmetric dimethylarginine.
21923750 In hypoxic human pulmonary microvascular endothelial cells, overexpression of CAT-1 resulted in significantly greater L-arginine transport and NO production
21722652 In acute congestive heart failure acute renal impairment function and the modulation of metabolism and extracellular transport by the DDAH-1/CAT-1 system determine high ADMA and SDMA levels after therapy for acute congestive heart failure.
21308737 Data show that the CAT-1 isoform plays a role in arginine uptake.
21302286 Insulin increased hCATs-L-arginine transport, maximal transport capacity, and hCAT-1 expression. Sp1 nuclear protein abundance and binding to DNA, and SLC7A1 promoter activity was increased by insulin.
More...

AA Sequence

MGCKVLLNIGQQMLRRKVVDCSREETRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISF      1 - 70
LIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFDELI     71 - 140
GRPIGEFSRTHMTLNAPGVLAENPDIFAVIIILILTGLLTLGVKESAMVNKIFTCINVLVLGFIMVSGFV    141 - 210
KGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVK    211 - 280
NPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLDNNSPLPDAFKHVGWEGAKYAVAVGSLCALSAS    281 - 350
LLGSMFPMPRVIYAMAEDGLLFKFLANVNDRTKTPIIATLASGAVAAVMAFLFDLKDLVDLMSIGTLLAY    351 - 420
SLVAACVLVLRYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSK    421 - 490
ISGLIVNISTSLIAVLIITFCIVTVLGREALTKGALWAVFLLAGSALLCAVVTGVIWRQPESKTKLSFKV    491 - 560
PFLPVLPILSIFVNVYLMMQLDQGTWVRFAVWMLIGFIIYFGYGLWHSEEASLDADQARTPDGNLDQCK     561 - 629
//

Text Mined References (38)

PMID Year Title
26062636 2015 Estradiol augments while progesterone inhibits arginine transport in human endothelial cells through modulation of cationic amino acid transporter-1.
25416956 2014 A proteome-scale map of the human interactome network.
24040099 2013 Overexpression of arginine transporter CAT-1 is associated with accumulation of L-arginine and cell growth in human colorectal cancer tissue.
23841815 2013 Contribution of SLC7A1 genetic variant to hypertension, the TAMRISK study.
23009292 2013 Nitric oxide signalling pathway in Duchenne muscular dystrophy mice: up-regulation of L-arginine transporters.
22870827 2013 Differential topochemistry of three cationic amino acid transporter proteins, hCAT1, hCAT2 and hCAT3, in the adult human brain.
22705145 2012 Interaction of the cardiovascular risk marker asymmetric dimethylarginine (ADMA) with the human cationic amino acid transporter 1 (CAT1).
21923750 2011 Overexpression of cationic amino acid transporter-1 increases nitric oxide production in hypoxic human pulmonary microvascular endothelial cells.
21722652 2011 The biological effect of pharmacological treatment on dimethylaminohydrolases (DDAH-1) and cationic amino acid transporter-1 (CAT-1) expression in patients with acute congestive heart failure.
21308737 2011 CAT-1-mediated arginine uptake and regulation of nitric oxide synthases for the survival of human breast cancer cell lines.
More...