Property Summary

NCBI Gene PubMed Count 178
PubMed Score 639.26
PubTator Score 465.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 1.4
Disease Target Count Z-score Confidence
Parkinson's disease 392 4.687 2.3
Phenylketonuria 20 3.392 1.7
Disease Target Count
GTP cyclohydrolase I deficiency 1

Expression

  Differential Expression (23)

Disease log2 FC p
Bipolar Disorder 1.019 3.9e-02
aldosterone-producing adenoma -1.511 2.9e-02
breast carcinoma 1.100 1.0e-15
cutaneous lupus erythematosus 1.800 1.9e-03
dermatomyositis 2.200 1.3e-02
ductal carcinoma in situ 1.600 3.4e-04
glioblastoma 1.400 4.5e-02
group 4 medulloblastoma -2.100 2.8e-03
invasive ductal carcinoma 1.800 1.3e-02
juvenile dermatomyositis 2.553 2.6e-13
lung cancer -2.700 1.1e-05
lung carcinoma 1.100 2.9e-05
malignant mesothelioma -2.300 6.3e-08
medulloblastoma, large-cell -1.900 1.0e-03
oligodendroglioma -2.300 1.7e-02
osteosarcoma -1.429 2.5e-02
ovarian cancer -1.400 1.4e-02
pancreatic ductal adenocarcinoma liver m... -3.420 3.5e-03
primary Sjogren syndrome 1.600 6.5e-04
primitive neuroectodermal tumor 1.300 3.0e-02
psoriasis 1.300 2.0e-07
sarcoidosis 1.500 3.2e-02
urothelial carcinoma -1.500 1.5e-03

Gene RIF (133)

AA Sequence

MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPN      1 - 70
LAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSM     71 - 140
CEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATH    141 - 210
MCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS                                  211 - 250
//

Text Mined References (186)

PMID Year Title