Property Summary

NCBI Gene PubMed Count 45
Grant Count 51
R01 Count 26
Funding $9,767,488.69
PubMed Score 316.27
PubTator Score 89.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Waldenstrons macroglobulinemia 2.480 0.013
Multiple myeloma 1.284 0.002
astrocytic glioma -1.100 0.041
psoriasis 2.000 0.001
cutaneous lupus erythematosus 1.200 0.015
osteosarcoma -4.379 0.000
posterior fossa group B ependymoma 1.500 0.000
glioblastoma 2.600 0.000
medulloblastoma, large-cell -2.300 0.000
juvenile dermatomyositis 1.047 0.000
acute quadriplegic myopathy 1.651 0.000
Atopic dermatitis 1.200 0.002
non-small cell lung cancer -1.687 0.000
colon cancer 1.300 0.039
lung cancer -4.200 0.000
diabetes mellitus -1.400 0.010
pilocytic astrocytoma 1.400 0.000
subependymal giant cell astrocytoma 1.735 0.015
nasopharyngeal carcinoma -1.500 0.000
lung carcinoma -1.600 0.000
spina bifida -1.060 0.036
ovarian cancer 3.100 0.000

Gene RIF (14)

PMID Text
26993499 Data show that oropharyngeal squamous cell carcinomas (OPSCCs) express granzyme inhibitors SERPINB1, SERPINB4 and SERPINB9 for cytotoxicity and the expression was not different between human papillomavirus (HPV)-positive and HPV-negative tumors.
26963506 Pediatric CNS-PNETs evade immune recognition by downregulating cell surface MHC-I and CD1d expression. Intriguingly, expression of SERPINB9, SERPINB1, and SERPINB4 is acquired during tumorigenesis in 29%, 29%, and 57% of the tumors
24968089 Data suggest that serine protease inhibitor (SERPIN) B1 negatively regulates glioma cell migration and invasion probably by abrogating the expression of matrix metalloproteinase-2 and the activation of focal adhesion kinase.
24852194 is not expressed in neutrophils of both sulfur mustard-exposed and chronic obstructive pulmonary disease patients
24105272 Decreased expression of SERPINB1 correlates with tumor invasion and poor prognosis in hepatocellular carcinoma.
23673989 Apoptosis-inducing factor and leukocyte elastase inhibitor derived DNase II interact and can cooperate to induce cell death.
23269243 Upon reactive center loop cleavage at Phe-343,SERPINB1 covalently complexes with GzmH. SERPINB1 overexpression suppresses GzmH- or LAK cell-mediated cytotoxicity. Crystal structures show possible conformational changes in GzmH for the suicide inhibition.
23002442 In the resting state during human neutrophil extracellar trap generation, SerpinB1 is exclusively in the cytoplasm, consistent with the current understanding of clade B serpins, and it may migrate and regulate events in the cell nucleus.
22421620 These results suggest that serpin B1 may be a novel marker of active ulcerative colitis and may play an important role in the pathogenesis of inflammatory bowel disease.
21248149 serpinB1 sustains a healthy neutrophil reserve that is required in acute immune responses.
More...

AA Sequence

MEQLSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHFNTVEEVHSRF      1 - 70
QSLNADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVDFQHASEDARKTINQWVKGQT     71 - 140
EGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIE    141 - 210
DLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEE    211 - 280
SYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPEE    281 - 350
NFTADHPFLFFIRHNSSGSILFLGRFSSP                                             351 - 379
//

Text Mined References (51)

PMID Year Title
26993499 2016 Oropharyngeal squamous cell carcinomas differentially express granzyme inhibitors.
26963506 2016 Pediatric Primitive Neuroectodermal Tumors of the Central Nervous System Differentially Express Granzyme Inhibitors.
24968089 2015 Serine protease inhibitor (SERPIN) B1 suppresses cell migration and invasion in glioma cells.
24852194 Comparative proteome analysis of peripheral neutrophils from sulfur mustard-exposed and COPD patients.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
24105272 2014 Decreased expression of SERPINB1 correlates with tumor invasion and poor prognosis in hepatocellular carcinoma.
23673989 2013 Apoptosis-inducing factor (AIF) and leukocyte elastase inhibitor/L-DNase II (LEI/LDNaseII), can interact to conduct caspase-independent cell death.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...