Property Summary

NCBI Gene PubMed Count 1,644
Grant Count 169
R01 Count 83
Funding $10,983,727.81
PubMed Score 860.00
PubTator Score 1412.50

Knowledge Summary

Patent

No data available

Synonym

Accession P30711 O00226 Q5TZY2 Q6IC69 Q969K8 Q96IY3
Symbols

Gene

PDB

2C3N   2C3Q   2C3T  

Gene RIF (1967)

PMID Text
27090234 Data show a combined role of cytochrome P 450 1A1 (CYP1A1), Glutathione -S -transferase M1 (GSTM1) and T1 (GSTT1) polymorphisms and smoking status can be attributed for the cause of lung cancer.
26970898 polymorphisms modified bromo-trihalomethane exposure relation to semen quality
26823865 we suggest that the GSTM1 null genotype and GSTT1 null genotype are correlated with an increased risk of gestational diabetes mellitus in a Chinese population.
26782535 No statistically significant association was found between GSTM1 or GSTT1 null genotypes and varicocele in the overall data analysis. (Meta-analysis)
26782376 The null or present polymorphism of GSTM1 and GSTT1 genes and Arg/Pro of the p53 gene were analyzed.
26663067 Data suggest that the combined genotypes of glutathionine S-transferase GSTM1 (-/-), GSTT1 (+/+), GSTP1 (AA) and meiotic recombination protein SPO11 (CT) may be associated with idiopathic male infertility in ethnic Han Chinese.
26656529 our meta-analysis suggests there is an association between GSTM1 and GSTT1 polymorphisms and RCC.
26604430 results show that GSTT1 null and MDR1 polymorphisms could play a role in susceptibility to inflammatory bowel disease
26580648 Effect of traditional healthy diet on reduced atopic dermatitis was significant or borderline significant in the GSTM1-present group or the GSTM1/T1 double present group. These associations did not exist in the animal foods and sweets dietary patterns.
26571237 individuals with GSTM1 null genotype and in combination with GSTT1 null and GSTP1 (AG+GG) have a survival advantage in cervical cancer patients
More...

AA Sequence

MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTESVAI      1 - 70
LLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAEL     71 - 140
DVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEA    141 - 210
HEVILKAKDFPPADPTIKQKLMPWVLAMIR                                            211 - 240
//

Text Mined References (1645)

PMID Year Title
27090234 2016 Association of CYP1A1, GSTM1 and GSTT1 gene polymorphisms with risk of non-small cell lung cancer in Andhra Pradesh region of South India.
26970898 2016 Interactions between CYP2E1, GSTZ1 and GSTT1 polymorphisms and exposure to drinking water trihalomethanes and their association with semen quality.
26823865 2015 Association of GSTs polymorphisms with risk of gestational diabetes mellitus.
26782535 2015 Glutathione S-transferase polymorphisms in varicocele patients: a meta-analysis.
26782376 2015 Polymorphisms of GSTM1, GSTT1, and p53 in Goiânia, Goiás.
26663067 2015 [Association of SPO11 and GST gene polymorphisms with idiopathic male infertility in ethnic Han Chinese].
26656529 2015 GSTM1 and GSTT1 polymorphisms contribute to renal cell carcinoma risk: evidence from an updated meta-analysis.
26604430 2015 Genetic Polymorphisms of Multidrug Resistance Gene-1 (MDR1/ABCB1) and Glutathione S-Transferase Gene and the Risk of Inflammatory Bowel Disease among Moroccan Patients.
26580648 2015 Association between Dietary Patterns and Atopic Dermatitis in Relation to GSTM1 and GSTT1 Polymorphisms in Young Children.
26571237 2015 Glutathione S-Transferase Gene Polymorphisms and Treatment Outcome in Cervical Cancer Patients under Concomitant Chemoradiation.
More...