Property Summary

NCBI Gene PubMed Count 1,714
PubMed Score 876.12
PubTator Score 1412.50

Knowledge Summary

Patent

No data available

Gene RIF (2036)

AA Sequence

MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTESVAI      1 - 70
LLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAEL     71 - 140
DVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEA    141 - 210
HEVILKAKDFPPADPTIKQKLMPWVLAMIR                                            211 - 240
//

Text Mined References (1715)

PMID Year Title