Property Summary

NCBI Gene PubMed Count 44
PubMed Score 487.68
PubTator Score 67.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease 1.914 2.4e-02
active ulcerative colitis 2.307 4.4e-03
atypical teratoid / rhabdoid tumor -1.200 1.6e-04
esophageal adenocarcinoma -2.500 2.3e-02
group 3 medulloblastoma -1.300 4.0e-03
lung carcinoma -1.900 1.6e-22
medulloblastoma, large-cell -1.500 2.7e-03
ovarian cancer 1.500 2.6e-04
pancreatic cancer 1.200 1.3e-04
pancreatic ductal adenocarcinoma liver m... 1.110 3.9e-02
primitive neuroectodermal tumor -1.300 2.3e-03
psoriasis 1.400 6.6e-08
tuberculosis -1.300 3.0e-04

 MGI Phenotype (1)

Protein-protein Interaction (4)

Gene RIF (14)

AA Sequence

MARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPGESGKSTFIKQMRIIHGAGY      1 - 70
SEEERKGFRPLVYQNIFVSMRAMIEAMERLQIPFSRPESKHHASLVMSQDPYKVTTFEKRYAAAMQWLWR     71 - 140
DAGIRAYYERRREFHLLDSAVYYLSHLERITEEGYVPTAQDVLRSRMPTTGINEYCFSVQKTNLRIVDVG    141 - 210
GQKSERKKWIHCFENVIALIYLASLSEYDQCLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTD    211 - 280
ILEEKIPTSHLATYFPSFQGPKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQ    281 - 350
NIRKVFKDVRDSVLARYLDEINLL                                                  351 - 374
//

Text Mined References (46)

PMID Year Title