Property Summary

NCBI Gene PubMed Count 44
Grant Count 60
R01 Count 45
Funding $6,534,909.9
PubMed Score 475.03
PubTator Score 67.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

 MGI Term (1)

 GWAS Trait (1)

Gene RIF (14)

PMID Text
25701539 GNA15 was not expressed in normal neuroendocrine cells but was overexpressed in gastroenteropancreatic neuroendocrine neoplasia cell lines.
24204697 Data indicate the importance of Galpha16 as a downstream effector of the non-canonical Wnt signaling pathway and as a potential therapeutic target for the treatment of non small cell lung cancer.
23200847 G15 ectopic presence could functionally contribute to the transformation process since siRNA-induced depletion of Galpha15 in pancreatic carcinoma cell lines dramatically inhibited anchorage-independent growth and resistance to the lack of nutrients.
22227248 This paper shows how G alpha 15 and other Gq class members phosphorylate PKD in differing patterns
21486497 beta3 region of Galpha16 is essential for interaction with TPR1 and the subsequent activation of Ras
20150327 This review summarizes the specific features that distinguish Galpha15/GNA15 (G15 alpha subunit) from all other alpha subunits of the Gq class. G15 is a heterotrimeric G protein complex that is named after its alpha subunit.
19687291 The ability of CCR1 to signal through Galpha(14/16) thus provides a linkage for chemokines to regulate NF-kappaB-dependent responses.
19275934 The paper describes G alpha 15 resistance to arrestin-desensitization making it differ from other heterotrimeric G proteins (Gq, Gs, Gi, G12/13 class)
18755267 Co-stimulation of G(s) and G(q) can result in the fine-tuning of STAT3 activation status, and this may provide the basis for cell type-specific responses following activation of hIP.
16218966 Results suggest that the G(q) class proteins are degraded through the proteasome pathway and that cellular localization and/or other protein interactions determine their stability.
More...

AA Sequence

MARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPGESGKSTFIKQMRIIHGAGY      1 - 70
SEEERKGFRPLVYQNIFVSMRAMIEAMERLQIPFSRPESKHHASLVMSQDPYKVTTFEKRYAAAMQWLWR     71 - 140
DAGIRAYYERRREFHLLDSAVYYLSHLERITEEGYVPTAQDVLRSRMPTTGINEYCFSVQKTNLRIVDVG    141 - 210
GQKSERKKWIHCFENVIALIYLASLSEYDQCLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTD    211 - 280
ILEEKIPTSHLATYFPSFQGPKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQ    281 - 350
NIRKVFKDVRDSVLARYLDEINLL                                                  351 - 374
//

Text Mined References (46)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25701539 2015 GNA15 expression in small intestinal neuroendocrine neoplasia: functional and signalling pathway analyses.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24204697 2013 Heterotrimeric G-protein, G?16, is a critical downstream effector of non-canonical Wnt signaling and a potent inhibitor of transformed cell growth in non small cell lung cancer.
23200847 2013 Ectopic expression of the heterotrimeric G15 protein in pancreatic carcinoma and its potential in cancer signal transduction.
22227248 2012 Differential PKC-dependent and -independent PKD activation by G protein ? subunits of the Gq family: selective stimulation of PKD Ser??? autophosphorylation by G?q.
21486497 2011 G?16 interacts with tetratricopeptide repeat 1 (TPR1) through its ?3 region to activate Ras independently of phospholipase C? signaling.
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
20445134 2010 Association of genome-wide variation with the risk of incident heart failure in adults of European and African ancestry: a prospective meta-analysis from the cohorts for heart and aging research in genomic epidemiology (CHARGE) consortium.
20150327 2010 The puzzling uniqueness of the heterotrimeric G15 protein and its potential beyond hematopoiesis.
More...