Property Summary

NCBI Gene PubMed Count 61
PubMed Score 468.18
PubTator Score 3804.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
glioblastoma multiforme 347 9.79449157995859E-25
astrocytoma 1493 6.96728477993044E-22
non-small cell lung cancer 2798 1.76970590537999E-17
oligodendroglioma 2849 3.94186569889959E-12
group 4 medulloblastoma 1875 3.88584022726857E-8
lung adenocarcinoma 2714 4.67391831676614E-8
ulcerative colitis 2087 6.65181279915997E-8
medulloblastoma, large-cell 6234 6.20471959975382E-7
Breast cancer 3099 1.41005856845461E-5
colon cancer 1475 3.79936057050195E-5
lung cancer 4473 8.70441873300084E-5
ovarian cancer 8492 2.20490897926349E-4
atypical teratoid / rhabdoid tumor 4369 6.00235489550632E-4
Multiple myeloma 1328 0.00117188281884889
chronic rhinosinusitis 512 0.0081637684759277
cystic fibrosis and chronic rhinosinusitis 213 0.0138753208776995
osteosarcoma 7933 0.0210278619835654
Waldenstrons macroglobulinemia 765 0.0320071271158644
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0329490486816171
Disease Target Count Z-score Confidence
Charcot-Marie-Tooth disease type 4 10 3.724 1.9
Cancer 2346 3.27 1.6

Expression

  Differential Expression (19)

Synonym

Accession P30626 A8MTH6 B4DKK2 D6W5Q0
Symbols SCN
V19
CP22
CP-22

Gene

SRI

PDB

1JUO   2JC2   4U8D   4UPG   4USL  

  Ortholog (12)

Gene RIF (32)

PMID Text
26719254 The authors verified that NS5A of hepatitis C virus interacted with sorcin through domain I of NS5A, and phosphorylation of the threonine residue 155 of sorcin played a crucial role in protein interaction.
26045737 Drug resistance can be effectively reversed in cisplatin-resistance and adriamycin-resistant myeloma cells through delivery of siRNAs targeting sorcin.
25505242 The interaction of HIV-1 CA with human cellular sorcin (SRI) is identified by yeast two-hybrid screen
25197934 Sorcin is highly expressed in the heart and in the brain, and overexpressed in many cancer cells. [Review]
25001342 Sorcin antibody as a possible predictive factor in conversion from radiologically isolated syndrome to multiple sclerosis: a preliminary study
24796664 overexpression of sorcin increased the phosphorylation of CREB1 and the binding of CREB1 to the CRE sequence of mdr1/p-gp promoter, and induced the expression of MDR1/P-gp
24427308 Sorcin links calcium signaling to vesicle trafficking, regulates Polo-like kinase 1 and is necessary for mitosis.
24376145 Key cellular signaling pathways were triggered by sorcin silencing in the drug resistance of human nasopharyngeal carcinoma.
24337682 sorcin regulates epithelial-mesenchymal transition and cancer stem cells partly through E-cadherin and vascular endothelial growth factor expression.
24013575 down-regulation of sorcin did not alter expression or function of P-gp, but induced cell apoptosis and chemosensitivity in K562/ A02 and MCF-7/A02
More...

AA Sequence

MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPF      1 - 70
NLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQA     71 - 140
VNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV                141 - 198
//

Text Mined References (66)

PMID Year Title
26719254 2015 Nonstructural 5A Protein of Hepatitis C Virus Regulates Soluble Resistance-Related Calcium-Binding Protein Activity for Viral Propagation.
26045737 2015 shRNA-mediated silencing of sorcin increases drug chemosensitivity in myeloma KM3/DDP and U266/ADM cell lines.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25197934 2014 Sorcin, a calcium binding protein involved in the multidrug resistance mechanisms in cancer cells.
25001342 2014 Sorcin antibody as a possible predictive factor in conversion from radiologically isolated syndrome to multiple sclerosis: a preliminary study.
24796664 2014 Increased expression of sorcin is associated with multidrug resistance in leukemia cells via up-regulation of MDR1 expression through cAMP response element-binding protein.
24427308 2014 Sorcin links calcium signaling to vesicle trafficking, regulates Polo-like kinase 1 and is necessary for mitosis.
24376145 2014 Reversing effect of sorcin in the drug resistance of human nasopharyngeal carcinoma.
24337682 2014 Sorcin silencing inhibits epithelial-to-mesenchymal transition and suppresses breast cancer metastasis in vivo.
More...