Property Summary

NCBI Gene PubMed Count 63
PubMed Score 481.49
PubTator Score 3804.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active ulcerative colitis -1.554 9.7e-03
astrocytoma 1.100 7.0e-22
atypical teratoid / rhabdoid tumor -1.900 6.0e-04
Breast cancer -1.200 1.4e-05
chronic rhinosinusitis -1.846 8.2e-03
colon cancer -2.300 3.8e-05
cystic fibrosis and chronic rhinosinusit... -1.498 1.4e-02
glioblastoma multiforme 1.200 9.8e-25
group 3 medulloblastoma -1.700 5.1e-05
intraductal papillary-mucinous neoplasm ... 1.100 3.3e-02
lung adenocarcinoma -1.100 4.7e-08
lung cancer -1.600 8.7e-05
medulloblastoma, large-cell -3.000 6.2e-07
Multiple myeloma 1.684 1.2e-03
non-small cell lung cancer -1.587 1.8e-17
oligodendroglioma 1.200 3.9e-12
osteosarcoma -1.422 2.1e-02
ovarian cancer -1.500 3.5e-04
Waldenstrons macroglobulinemia 1.123 3.2e-02

Gene RIF (33)

AA Sequence

MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPF      1 - 70
NLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQA     71 - 140
VNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV                141 - 198
//

Text Mined References (68)

PMID Year Title