Property Summary

NCBI Gene PubMed Count 62
PubMed Score 343.72
PubTator Score 380.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
lung cancer -1.600 8.7e-03
adult high grade glioma -1.100 3.7e-02
aldosterone-producing adenoma -1.043 4.2e-02
Breast cancer -1.200 7.1e-10
esophageal adenocarcinoma -1.300 2.8e-02
gastric carcinoma 1.100 7.8e-03
glioblastoma -1.300 3.1e-04
hereditary spastic paraplegia -1.169 6.7e-03
medulloblastoma, large-cell -1.500 1.7e-04
osteosarcoma 1.573 5.9e-04
ovarian cancer 1.600 1.9e-03
periodontitis -1.100 1.8e-22
Pick disease 2.200 1.4e-04
posterior fossa group B ependymoma -1.200 2.0e-04
progressive supranuclear palsy 1.500 4.0e-02
psoriasis -1.400 9.1e-07
Rheumatoid arthritis 1.200 4.9e-02
sonic hedgehog group medulloblastoma -1.200 8.9e-03
spina bifida -1.194 3.0e-02

Gene RIF (36)

AA Sequence

MSMLKPSGLKAPTKILKPGSTALKTPTAVVAPVEKTISSEKASSTPSSETQEEFVDDFRVGERVWVNGNK      1 - 70
PGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKLTRKVQAEDEANGLQTT     71 - 140
PASRATSPLCTSTASMVSSSPSTPSNIPQKPSQPAAKEPSATPPISNLTKTASESISNLSEAGSIKKGER    141 - 210
ELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTK    211 - 280
IGFPSTTPAKAKANAVRRVMATTSASLKRSPSASSLSSMSSVASSVSSRPSRTGLLTETSSRYARKISGT    281 - 350
TALQEALKEKQQHIEQLLAERDLERAEVAKATSHVGEIEQELALARDGHDQHVLELEAKMDQLRTMVEAA    351 - 420
DREKVELLNQLEEEKRKVEDLQFRVEEESITKGDLEQKSQISEDPENTQTKLEHARIKELEQSLLFEKTK    421 - 490
ADKLQRELEDTRVATVSEKSRIMELEKDLALRVQEVAELRRRLESNKPAGDVDMSLSLLQEISSLQEKLE    491 - 560
VTRTDHQREITSLKEHFGAREETHQKEIKALYTATEKLSKENESLKSKLEHANKENSDVIALWKSKLETA    561 - 630
IASHQQAMEELKVSFSKGLGTETAEFAELKTQIEKMRLDYQHEIENLQNQQDSERAAHAKEMEALRAKLM    631 - 700
KVIKEKENSLEAIRSKLDKAEDQHLVEMEDTLNKLQEAEIKVKELEVLQAKCNEQTKVIDNFTSQLKATE    701 - 770
EKLLDLDALRKASSEGKSEMKKLRQQLEAAEKQIKHLEIEKNAESSKASSITRELQGRELKLTNLQENLS    771 - 840
EVSQVKETLEKELQILKEKFAEASEEAVSVQRSMQETVNKLHQKEEQFNMLSSDLEKLRENLADMEAKFR    841 - 910
EKDEREEQLIKAKEKLENDIAEIMKMSGDNSSQLTKMNDELRLKERDVEELQLKLTKANENASFLQKSIE    911 - 980
DMTVKAEQSQQEAAKKHEEEKKELERKLSDLEKKMETSHNQCQELKARYERATSETKTKHEEILQNLQKT    981 - 1050
LLDTEDKLKGAREENSGLLQELEELRKQADKAKAAQTAEDAMQIMEQMTKEKTETLASLEDTKQTNAKLQ   1051 - 1120
NELDTLKENNLKNVEELNKSKELLTVENQKMEEFRKEIETLKQAAAQKSQQLSALQEENVKLAEELGRSR   1121 - 1190
DEVTSHQKLEEERSVLNNQLLEMKKRESKFIKDADEEKASLQKSISITSALLTEKDAELEKLRNEVTVLR   1191 - 1260
GENASAKSLHSVVQTLESDKVKLELKVKNLELQLKENKRQLSSSSGNTDTQADEDERAQESQIDFLNSVI   1261 - 1330
VDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMS   1331 - 1400
EDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDETF                                   1401 - 1438
//

Text Mined References (71)

PMID Year Title