Property Summary

NCBI Gene PubMed Count 62
Grant Count 60
R01 Count 37
Funding $8,078,355.97
PubMed Score 322.09
PubTator Score 380.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.049
esophageal adenocarcinoma -1.300 0.028
osteosarcoma 2.191 0.000
periodontitis -1.100 0.000
glioblastoma -1.300 0.000
medulloblastoma, large-cell -1.800 0.001
hereditary spastic paraplegia -1.570 0.002
lung cancer -1.600 0.009
adult high grade glioma -1.100 0.037
posterior fossa group B ependymoma -1.200 0.000
sonic hedgehog group medulloblastoma -1.200 0.009
aldosterone-producing adenoma -1.043 0.042
psoriasis -1.400 0.000
spina bifida -1.194 0.030
Pick disease 2.200 0.000
progressive supranuclear palsy 1.500 0.040
Breast cancer -1.800 0.000
gastric carcinoma 1.100 0.008
ovarian cancer 1.600 0.002

Synonym

Accession P30622 A0AVD3 Q17RS4 Q29RG0
Symbols RSN
CLIP
CYLN1
CLIP170
CLIP-170

Gene

PDB

2CP5   2CP6   2E3H   2E3I   2E4H   2HQH   2QK0   3E2U   3RDV  

Gene RIF (36)

PMID Text
27199431 single-molecule fluorescence microscopy showed that the microtubule plus-end-associated protein CLIP-170 binds tightly to formins to accelerate actin filament elongation.
26506308 We show that AMPH-1/BIN1 binds to nesprin and actin, as well as to the microtubule-binding protein CLIP170 in both species. We propose that BIN1 has a direct and evolutionarily conserved role in nuclear positioning, altered in myopathies.
26504169 herpesvirus particles are absolutely dependent on CLIP-170-mediated capture to initiate transport in primary human cells.
26231764 CLIP-170 tethers kinetochores to microtubule ends against the dynein-mediated poleward force to slide kinetochores along microtubules
25972084 Restin inhibits epithelial-mesenchymal transition and tumor metastasis by controlling the expression of the tumor metastasis suppressor mir-200a/b via association with p73.
25413345 We find that LRRK1-mediated phosphorylation of CLIP-170 causes the accumulation of p150(Glued) (also known as DCTN1) a subunit of dynactin, at microtubule plus ends, thereby facilitating the migration of EGFR-containing endosomes.
24777477 Data suggest that CLIP-170 acts as a novel recruiter and spatial regulator of PLK1 at kinetochores during early mitosis, promoting K-fiber stability and chromosome alignment for error-free chromosome segregation.
24569606 A defect in the CLIP1 gene (CLIP-170) can cause autosomal recessive intellectual disability.
24530770 siRNA-mediated knockdown of the cytoplasmic linker protein compromised the assembly and branching of capillary-like blood vessels and neovascularization in vivo. It was critical for the motility abilities of HUVECs through its actions on cell polarity.
24474193 HDAC6 interacts with cytoplasmic linker protein 170 (CLIP-170) and that these two proteins function together to stimulate the migration of pancreatic cancer cells.
More...

AA Sequence

MSMLKPSGLKAPTKILKPGSTALKTPTAVVAPVEKTISSEKASSTPSSETQEEFVDDFRVGERVWVNGNK      1 - 70
PGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKLTRKVQAEDEANGLQTT     71 - 140
PASRATSPLCTSTASMVSSSPSTPSNIPQKPSQPAAKEPSATPPISNLTKTASESISNLSEAGSIKKGER    141 - 210
ELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTK    211 - 280
IGFPSTTPAKAKANAVRRVMATTSASLKRSPSASSLSSMSSVASSVSSRPSRTGLLTETSSRYARKISGT    281 - 350
TALQEALKEKQQHIEQLLAERDLERAEVAKATSHVGEIEQELALARDGHDQHVLELEAKMDQLRTMVEAA    351 - 420
DREKVELLNQLEEEKRKVEDLQFRVEEESITKGDLEQKSQISEDPENTQTKLEHARIKELEQSLLFEKTK    421 - 490
ADKLQRELEDTRVATVSEKSRIMELEKDLALRVQEVAELRRRLESNKPAGDVDMSLSLLQEISSLQEKLE    491 - 560
VTRTDHQREITSLKEHFGAREETHQKEIKALYTATEKLSKENESLKSKLEHANKENSDVIALWKSKLETA    561 - 630
IASHQQAMEELKVSFSKGLGTETAEFAELKTQIEKMRLDYQHEIENLQNQQDSERAAHAKEMEALRAKLM    631 - 700
KVIKEKENSLEAIRSKLDKAEDQHLVEMEDTLNKLQEAEIKVKELEVLQAKCNEQTKVIDNFTSQLKATE    701 - 770
EKLLDLDALRKASSEGKSEMKKLRQQLEAAEKQIKHLEIEKNAESSKASSITRELQGRELKLTNLQENLS    771 - 840
EVSQVKETLEKELQILKEKFAEASEEAVSVQRSMQETVNKLHQKEEQFNMLSSDLEKLRENLADMEAKFR    841 - 910
EKDEREEQLIKAKEKLENDIAEIMKMSGDNSSQLTKMNDELRLKERDVEELQLKLTKANENASFLQKSIE    911 - 980
DMTVKAEQSQQEAAKKHEEEKKELERKLSDLEKKMETSHNQCQELKARYERATSETKTKHEEILQNLQKT    981 - 1050
LLDTEDKLKGAREENSGLLQELEELRKQADKAKAAQTAEDAMQIMEQMTKEKTETLASLEDTKQTNAKLQ   1051 - 1120
NELDTLKENNLKNVEELNKSKELLTVENQKMEEFRKEIETLKQAAAQKSQQLSALQEENVKLAEELGRSR   1121 - 1190
DEVTSHQKLEEERSVLNNQLLEMKKRESKFIKDADEEKASLQKSISITSALLTEKDAELEKLRNEVTVLR   1191 - 1260
GENASAKSLHSVVQTLESDKVKLELKVKNLELQLKENKRQLSSSSGNTDTQADEDERAQESQIDFLNSVI   1261 - 1330
VDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMS   1331 - 1400
EDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDETF                                   1401 - 1438
//

Text Mined References (71)

PMID Year Title
27199431 2016 Accelerated actin filament polymerization from microtubule plus ends.
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26506308 2015 Amphiphysin 2 Orchestrates Nucleus Positioning and Shape by Linking the Nuclear Envelope to the Actin and Microtubule Cytoskeleton.
26504169 2015 Microtubule plus end-associated CLIP-170 initiates HSV-1 retrograde transport in primary human cells.
26231764 2015 CLIP-170 tethers kinetochores to microtubule plus ends against poleward force by dynein for stable kinetochore-microtubule attachment.
25972084 2015 Restin suppressed epithelial-mesenchymal transition and tumor metastasis in breast cancer cells through upregulating mir-200a/b expression via association with p73.
25413345 2015 LRRK1-phosphorylated CLIP-170 regulates EGFR trafficking by recruiting p150Glued to microtubule plus ends.
24777477 2014 CLIP-170 recruits PLK1 to kinetochores during early mitosis for chromosome alignment.
24569606 2015 A defect in the CLIP1 gene (CLIP-170) can cause autosomal recessive intellectual disability.
24530770 2014 Identification of a cytoplasmic linker protein as a potential target for neovascularization.
More...