Property Summary

NCBI Gene PubMed Count 91
PubMed Score 231.12
PubTator Score 237.65

Knowledge Summary

Patent (92,775)

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.100 2.0e-04
malignant mesothelioma 1.600 2.0e-07
medulloblastoma, large-cell 1.400 1.9e-05
osteosarcoma -2.104 9.6e-05
psoriasis -4.000 4.5e-06

Gene RIF (53)

AA Sequence

MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQLTQELGTAFFQQQQLPAAMADTFL      1 - 70
EHLCLLDIDSEPVAARSTSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVREAVES     71 - 140
FAGSPLSYRPVAIALDTKGPEIRTGILQGGPESEVELVKGSQVLVTVDPAFRTRGNANTVWVDYPNIVRV    141 - 210
VPVGGRIYIDDGLISLVVQKIGPEGLVTQVENGGVLGSRKGVNLPGAQVDLPGLSEQDVRDLRFGVEHGV    211 - 280
DIVFASFVRKASDVAAVRAALGPEGHGIKIISKIENHEGVKRFDEILEVSDGIMVARGDLGIEIPAEKVF    281 - 350
LAQKMMIGRCNLAGKPVVCATQMLESMITKPRPTRAETSDVANAVLDGADCIMLSGETAKGNFPVEAVKM    351 - 420
QHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPR    421 - 490
AAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRP    491 - 560
GSGYTNIMRVLSIS                                                            561 - 574
//

Text Mined References (94)

PMID Year Title