Property Summary

Ligand Count 438
NCBI Gene PubMed Count 247
PubMed Score 820.81
PubTator Score 531.43

Knowledge Summary

Patent (26,702)


  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Disease of mental health 36 0.0 1.4


  Differential Expression (18)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 2.2e-02
Breast cancer -2.700 2.8e-02
breast carcinoma -2.200 2.2e-03
chronic rhinosinusitis -1.964 2.9e-02
ductal carcinoma in situ -2.300 4.9e-02
ependymoma -1.400 6.2e-03
glioblastoma multiforme 1.200 1.3e-07
group 4 medulloblastoma -2.200 5.4e-04
head and neck cancer -2.200 3.2e-02
intraductal papillary-mucinous neoplasm ... 1.700 4.5e-02
malignant mesothelioma 2.200 3.5e-08
medulloblastoma, large-cell -2.100 4.7e-03
nasopharyngeal carcinoma -1.300 1.1e-03
non-small cell lung cancer and chronic o... -1.600 1.2e-02
ovarian cancer 2.000 3.4e-04
pancreatic cancer 1.100 3.9e-04
pancreatic carcinoma 1.100 3.9e-04
primitive neuroectodermal tumor -1.700 9.6e-03

Gene RIF (246)

AA Sequence

YLKGRRLGETSASKKSNSSSFVLSHRSSSQRSCSQPSTA                                   351 - 389

Text Mined References (247)

PMID Year Title