Property Summary

NCBI Gene PubMed Count 211
Grant Count 203
R01 Count 79
Funding $29,231,989.67
PubMed Score 741.42
PubTator Score 531.43

Knowledge Summary

Patent (26,702)

Expression

Synonym

Accession P30559 Q15071 OT-R
Symbols OT-R

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

MLP Assay (10)

AID Type Active / Inconclusive / Inactive Description
2435 screening 1044 / 0 / 323814 Fluorescence-based primary cell-based high throughput screening assay to identify agonists of the Oxytocin Receptor (OXTR).
2445 screening 199 / 0 / 324659 Fluorescence-based primary cell-based high throughput screening assay to identify potentiators of Oxytocin Receptor (OXTR)
2481 summary 0 / 0 / 0 Summary of probe development efforts to identify potentiators of Oxytocin Receptor (OXTR)
2482 summary 0 / 0 / 0 Summary of probe development efforts to identify agonists of Oxytocin Receptor (OXTR)
434963 screening 65 / 0 / 321 Fluorescence-based cell-based high throughput confirmation assay for agonists of the Oxytocin Receptor (OXTR)
434969 screening 22 / 0 / 153 Counterscreen for vasopressin 1 receptor (V1R) agonists: Fluorescence-based cell-based high throughput screening assay to identify agonists of the Oxytocin Receptor (OXTR)
434985 screening 6 / 0 / 177 Fluorescence-based cell-based high throughput confirmation assay to identify potentiators of Oxytocin Receptor (OXTR)
463103 confirmatory 2 / 0 / 20 Fluorescence-based cell-based high throughput dose response assay for agonists of the Oxytocin Receptor (OXTR)
463125 confirmatory 0 / 0 / 5 Fluorescence-based cell-based high throughput dose response assay for potentiators of Oxytocin Receptor (OXTR)
463128 confirmatory 3 / 0 / 9 Counterscreen for vasopressin 1 receptor (V1R) agonists: Fluorescence-based cell-based high throughput dose response assay for agonists of the Oxytocin Receptor (OXTR)

Gene RIF (210)

PMID Text
27015428 on N170 were evident. Those effects were present in the first and in the second study. Whereas we found molecular-genetic associations of oxytocinergic polymorphisms with the N170 in the first study, we failed to do so in the replication sample
26903639 Data show that oxytocin receptor and estrogen receptor beta single nucleotide polymorphisms (SNPs) temper accelerated cellular aging in young females who tend to make impatient choices.
26738630 estimation of the gender and population differences in polymorphisms of two oxytocin receptor gene SNPs, rs53576 and rs2254298, in four populations
26599592 These findings suggest that genetic variations in the oxytocin receptor gene may not explain a significant part of alexithymia in patients with obsessive-compulsive disorder.
26506050 Variants of OXTR have been linked to individual differences in psychological and physiological response patterns to stress and social information.
26488131 The OXTR rs53576 genotype and attachment style are on social anxiety possibly constituting a targetable combined risk marker of social anxiety disorder.
26477647 The found of this study underscore a series of relations among a common oxytocin receptor gene variant, early life stress exposure, and structure and function of the amygdala in early life.
26444016 results indicate that the OXTR genotype affects attitudinal trust as part of an individual's relatively stable disposition, and further affects behavioral trust through changes in attitudinal trust.
26406593 Results show that genetic variants in the oestrogen receptor alpha and the oxytocin receptor may be associated with an increased risk of oesophageal adenocarcinoma and Barrett's oesophagus.
26389606 there was no evidence that OXTR rs53576 moderated the association between attachment security during early childhood and overall coherence of mind ("security") during the Adult Attachment Interview at age 18 years.
More...

AA Sequence

MEGALAANWSAEAANASAAPPGAEGNRTAGPPRRNEALARVEVAVLCLILLLALSGNACVLLALRTTRQK      1 - 70
HSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQVVGMFASTYLLLLMSLDRCLA     71 - 140
ICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREVADGVFDCWAVFIQPWGPKAYITWITLAVYI    141 - 210
VPVIVLAACYGLISFKIWQNLRLKTAAAAAAEAPEGAAAGDGGRVALARVSSVKLISKAKIRTVKMTFII    211 - 280
VLAFIVCWTPFFFVQMWSVWDANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSAS    281 - 350
YLKGRRLGETSASKKSNSSSFVLSHRSSSQRSCSQPSTA                                   351 - 389
//

Text Mined References (211)

PMID Year Title
27015428 2016 The Idea Is Good, but…: Failure to Replicate Associations of Oxytocinergic Polymorphisms with Face-Inversion in the N170.
26903639 2016 Delay discounting, genetic sensitivity, and leukocyte telomere length.
26738630 2016 Polymorphisms of two loci at the oxytocin receptor gene in populations of Africa, Asia and South Europe.
26599592 2015 Lack of Association between Oxytocin Receptor (OXTR) Gene Polymorphisms and Alexithymia: Evidence from Patients with Obsessive-Compulsive Disorder.
26506050 2015 Genetic modulation of oxytocin sensitivity: a pharmacogenetic approach.
26488131 2016 Attachment style and oxytocin receptor gene variation interact in influencing social anxiety.
26477647 2015 Amygdala responses to salient social cues vary with oxytocin receptor genotype in youth.
26444016 2015 Polymorphism of the Oxytocin Receptor Gene Modulates Behavioral and Attitudinal Trust among Men but Not Women.
26406593 2015 Polymorphisms in Genes of Relevance for Oestrogen and Oxytocin Pathways and Risk of Barrett's Oesophagus and Oesophageal Adenocarcinoma: A Pooled Analysis from the BEACON Consortium.
26389606 2015 Genetic moderation of stability in attachment security from early childhood to age 18 years: A replication study.
More...