Property Summary

Ligand Count 557
NCBI Gene PubMed Count 843
PubMed Score 2643.71
PubTator Score 4039.02

Knowledge Summary

Patent (46,045)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count
Renal dysplasia 28

Expression

  Differential Expression (20)

Disease log2 FC p
Atopic dermatitis -3.100 6.2e-05
breast carcinoma -1.500 1.8e-10
colon cancer -5.100 1.8e-12
cutaneous lupus erythematosus -1.500 1.9e-02
ductal carcinoma in situ -3.200 1.3e-03
glioblastoma 1.100 2.7e-02
group 3 medulloblastoma 2.200 3.4e-02
intraductal papillary-mucinous adenoma (... -3.000 7.4e-04
intraductal papillary-mucinous carcinoma... -3.100 9.7e-04
invasive ductal carcinoma -1.505 1.6e-03
lung adenocarcinoma -1.100 8.2e-16
lung cancer -1.300 2.5e-02
lung carcinoma -1.200 3.6e-10
malignant mesothelioma -6.100 4.9e-10
nephrosclerosis 1.094 3.8e-02
non-small cell lung cancer -2.505 4.3e-20
osteosarcoma -2.358 6.8e-04
ovarian cancer -3.600 2.7e-23
pancreatic ductal adenocarcinoma liver m... -2.971 2.5e-03
psoriasis -1.900 6.4e-05

 GWAS Trait (1)

 CSPA Cell Line (1)

Protein-protein Interaction (10)

Gene RIF (928)

AA Sequence

MILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNL      1 - 70
ALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRR     71 - 140
TMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFLFPFLI    141 - 210
ILTSYTLIWKALKKAYEIQKNKPRNDDIFKIIMAIVLFFFFSWIPHQIFTFLDVLIQLGIIRDCRIADIV    211 - 280
DTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTK    281 - 350
KPAPCFEVE                                                                 351 - 359
//

Text Mined References (846)

PMID Year Title