Property Summary

NCBI Gene PubMed Count 809
PubMed Score 2514.85
PubTator Score 4039.02

Knowledge Summary

Patent (46,045)

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
ovarian cancer 8492 2.67557896341902E-23
non-small cell lung cancer 2798 4.33480579649529E-20
lung adenocarcinoma 2714 7.8812263725996E-14
colon cancer 1475 1.77500300519821E-12
breast carcinoma 1614 1.75197955302591E-10
lung carcinoma 2844 3.61825425885045E-10
malignant mesothelioma 3163 4.94498049380315E-10
lung cancer 4473 1.94578256126694E-7
Atopic dermatitis 944 6.24222425355532E-5
psoriasis 6685 1.12563586638498E-4
group 4 medulloblastoma 1875 5.7954438918148E-4
osteosarcoma 7933 6.82426933637024E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.38021004088927E-4
invasive ductal carcinoma 2950 8.36929779566392E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.65975653999015E-4
ductal carcinoma in situ 1745 0.00127263000417845
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00254071180896287
cutaneous lupus erythematosus 1056 0.0185731639387623
glioblastoma 5572 0.0274045074170507
nephrosclerosis 329 0.0376200915493394
Disease Target Count
Renal tubular dysgenesis 4

Expression

  Differential Expression (20)

Disease log2 FC p
nephrosclerosis 1.094 0.038
malignant mesothelioma -6.100 0.000
psoriasis -3.000 0.000
cutaneous lupus erythematosus -1.500 0.019
osteosarcoma -2.358 0.001
group 4 medulloblastoma 3.200 0.001
glioblastoma 1.100 0.027
Atopic dermatitis -3.100 0.000
pancreatic ductal adenocarcinoma liver m... -2.971 0.003
non-small cell lung cancer -2.505 0.000
intraductal papillary-mucinous adenoma (... -3.000 0.001
intraductal papillary-mucinous carcinoma... -3.100 0.001
lung cancer -4.600 0.000
colon cancer -5.100 0.000
lung adenocarcinoma -2.113 0.000
invasive ductal carcinoma -4.100 0.001
lung carcinoma -1.200 0.000
breast carcinoma -1.500 0.000
ductal carcinoma in situ -3.200 0.001
ovarian cancer -3.600 0.000

Synonym

Accession P30556 Q13725 Q8TBK4
Symbols AT1
AG2S
AT1B
AT1R
AT1AR
AT1BR
AT2R1
HAT1R
AGTR1B

Gene

PANTHER Protein Class (2)

PDB

1ZV0   4YAY   4ZUD  

  Ortholog (10)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

  TechDev Info (1)

 CSPA Cell Line (1)

MLP Assay (12)

AID Type Active / Inconclusive / Inactive Description
463214 confirmatory 204 / 0 / 181 Dose Response screen for antagonists of Angiotensin II Receptor Type 1 to assess selectivity of uHTS small molecule antagonists hits of the APJ receptor
488810 confirmatory 44 / 0 / 115 SAR analysis of antagonists of Angiotensin II Receptor Type 1 to assess selectivity of uHTS small molecule antagonists hits of the APJ receptor
488865 confirmatory 1 / 0 / 76 Dose Response screen for agonists of Angiotensin II Receptor Type 1 to assess selectivity of uHTS small molecule agonists hits of the APJ receptor
488881 confirmatory 1 / 0 / 42 SAR analysis of small molecule agonists of the Angiotensin II Receptor Type 1 to assess selectivity of uHTS small molecule agonists hits of the APJ receptor
488986 confirmatory 1 / 0 / 17 SAR analysis of small molecule agonists of the Angiotensin II Receptor Type 1 to assess selectivity of uHTS small molecule agonists hits of the APJ receptor - Set 2
488994 confirmatory 0 / 0 / 10 SAR analysis of antagonists of Angiotensin II Receptor Type 1 to assess selectivity of uHTS small molecule antagonists hits of the APJ receptor - Set 2
492982 confirmatory 0 / 0 / 3 SAR analysis of small molecule agonists of the Angiotensin II Receptor Type 1 to assess selectivity of uHTS small molecule agonists hits of the APJ receptor - Set 3
492984 confirmatory 0 / 0 / 7 SAR analysis of antagonists of Angiotensin II Receptor Type 1 to assess selectivity of uHTS small molecule antagonists hits of the APJ receptor - Set 3
493202 confirmatory 0 / 0 / 7 SAR analysis of small molecule agonists of the Angiotensin II Receptor Type 1 to assess selectivity of uHTS small molecule agonists hits of the APJ receptor - Set 4
504438 confirmatory 0 / 0 / 8 SAR analysis of antagonists of Angiotensin II Receptor Type 1 to assess selectivity of uHTS small molecule antagonists hits of the APJ receptor - Set 4
More...

Gene RIF (895)

PMID Text
26975580 Findings suggest that angiotensin II type I receptor (AGTR1) plays a significant role in tumor aggressiveness, and its inhibition may have therapeutic implications.
26782590 The AGTR1 gene A1166C polymorphism may not be correlated with IgA nephropathy susceptibility.
26681690 AT1R mRNA is regulated by TIA-1 in a ER stress-dependent manner.
26675563 No difference in the overall post-heart transplant survival and freedom from acute cellular and antibody-mediated rejection between anti-AT1R-negative and anti-AT1R-positive Heart Mate II bridged recipients.
26658476 Data suggest that CpG dinucleotides CpG1 hypomethylation in the angiotensin II type 1 receptor (AGTR1) promoter is likely associated with the risk of essential hypertension (EH) in the population assessed.
26626074 Our results suggest that silencing of AT1R inhibits EMT induced by HG in HK-2 cells via inactivation of mTOR/p70S6K signaling pathway.
26588355 rs699 in the AGT gene and rs5186 in the ATR1 gene were not associated with the risk and clinical outcomes of IgAN.
26524813 the AT1R Al166C polymorphism was significantly associated with the pregnancy-induced hypertension, especially in Asian subjects (Meta-Analysis)
26420482 analysis of crystal structure of the human AT1R in complex with an inverse agonist olmesartan (Benicar(TM)), a highly potent anti-hypertensive drug
26366788 Our findings indicate that epidermal growth factor, interleukin-1beta and angiotensin II receptor, type 1 may play important roles in the pathogenesis of endometriosis.
More...

AA Sequence

MILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNL      1 - 70
ALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRR     71 - 140
TMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFLFPFLI    141 - 210
ILTSYTLIWKALKKAYEIQKNKPRNDDIFKIIMAIVLFFFFSWIPHQIFTFLDVLIQLGIIRDCRIADIV    211 - 280
DTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTK    281 - 350
KPAPCFEVE                                                                 351 - 359
//

Text Mined References (812)

PMID Year Title
26975580 2016 Overexpression of angiotensin II type 1 receptor in breast cancer cells induces epithelial-mesenchymal transition and promotes tumor growth and angiogenesis.
26782590 2015 Association between the AGTR1 A1166C polymorphism and risk of IgA nephropathy: a meta-analysis.
26681690 2016 Endoplasmic reticulum stress increases AT1R mRNA expression via TIA-1-dependent mechanism.
26675563 2016 The impact of angiotensin II type 1 receptor antibodies on post-heart transplantation outcome in Heart Mate II bridged recipients.
26658476 2015 Association of AGTR1 Promoter Methylation Levels with Essential Hypertension Risk: A Matched Case-Control Study.
26626074 2016 Silencing of angiotensin II type-1 receptor inhibits high glucose-induced epithelial-mesenchymal transition in human renal proximal tubular epithelial cells via inactivation of mTOR/p70S6K signaling pathway.
26588355 2015 Lack of Association Between Polymorphisms in AGT and ATR1 and IgA Nephropathy in a Chinese Population.
26524813 2015 AT1R A1166C polymorphism and risk of pregnancy-induced hypertension: a meta-analysis of case control studies.
26460884 2015 G protein-coupled receptors directly bind filamin A with high affinity and promote filamin phosphorylation.
26420482 2015 Structural Basis for Ligand Recognition and Functional Selectivity at Angiotensin Receptor.
More...