Property Summary

NCBI Gene PubMed Count 809
Grant Count 591
R01 Count 409
Funding $56,488,649.77
PubMed Score 2514.85
PubTator Score 4039.02

Knowledge Summary

Patent (46,045)

TINX Plot

  Disease Relevance (52)

Disease Z-score Confidence
Hypertension 287 6.79 3.4
Kidney disease 396 5.462 2.7
Coronary artery disease 240 5.152 2.6
diabetes mellitus 1,663 4.752 2.4
Heart disease 279 4.643 2.3
Atherosclerosis 275 4.376 2.2
Cerebrovascular disease 231 4.339 2.2
Metabolic syndrome X 155 3.553 1.8
Obesity 616 3.365 1.7
Aortic aneurysm 34 3.159 1.6
Cancer 2,346 3.055 1.5
Allanson Pantzar McLeod syndrome 4
Aortic Aneurysm, Abdominal 10
Atopic dermatitis 944
Carcinoma, Pancreatic Ductal 19
Cerebrovascular accident 44
Chronic heart failure 46
Diabetic Retinopathy 53
Diabetic renal disease 4
Essential Hypertension 82
Heart failure 80
Hypertension with Left Ventricular Hyper... 3 
Hypertensive disease 193
Hypertensive disorder 58
Hypertensive urgency 10
Kidney Diseases 86
Left ventricular cardiac dysfunction 9
Myocardial Infarction Prevention 7
Neoplasm Metastasis 138
Patent ductus arteriosus 23
Pituitary Neoplasms 6
Proteinuria 63
Spontaneous abortion 108
breast carcinoma 1,614
colon cancer 1,475
cutaneous lupus erythematosus 1,056
ductal carcinoma in situ 1,745
glioblastoma 5,572
group 4 medulloblastoma 1,875
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
nephrosclerosis 329
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic ductal adenocarcinoma liver m... 1,795 
psoriasis 6,685

Expression

  Differential Expression (20)

Disease log2 FC p
nephrosclerosis 1.094 0.038
malignant mesothelioma -6.100 0.000
psoriasis -3.000 0.000
cutaneous lupus erythematosus -1.500 0.019
osteosarcoma -2.358 0.001
group 4 medulloblastoma 3.200 0.001
glioblastoma 1.100 0.027
Atopic dermatitis -3.100 0.000
pancreatic ductal adenocarcinoma liver m... -2.971 0.003
non-small cell lung cancer -2.505 0.000
intraductal papillary-mucinous adenoma (... -3.000 0.001
intraductal papillary-mucinous carcinoma... -3.100 0.001
lung cancer -4.600 0.000
colon cancer -5.100 0.000
lung adenocarcinoma -2.113 0.000
invasive ductal carcinoma -4.100 0.001
lung carcinoma -1.200 0.000
breast carcinoma -1.500 0.000
ductal carcinoma in situ -3.200 0.001
ovarian cancer -3.600 0.000

Synonym

Accession P30556 Q13725 Q8TBK4
Symbols AT1
AG2S
AT1B
AT1R
AT1AR
AT1BR
AT2R1
HAT1R
AGTR1B

Gene

PANTHER Protein Class (2)

PDB

1ZV0   4YAY   4ZUD  

  TechDev Info (1)

MLP Assay (12)

AID Type Active / Inconclusive / Inactive Description
463214 confirmatory 204 / 0 / 181 Dose Response screen for antagonists of Angiotensin II Receptor Type 1 to assess selectivity of uHTS small molecule antagonists hits of the APJ receptor
488810 confirmatory 44 / 0 / 115 SAR analysis of antagonists of Angiotensin II Receptor Type 1 to assess selectivity of uHTS small molecule antagonists hits of the APJ receptor
488865 confirmatory 1 / 0 / 76 Dose Response screen for agonists of Angiotensin II Receptor Type 1 to assess selectivity of uHTS small molecule agonists hits of the APJ receptor
488881 confirmatory 1 / 0 / 42 SAR analysis of small molecule agonists of the Angiotensin II Receptor Type 1 to assess selectivity of uHTS small molecule agonists hits of the APJ receptor
488986 confirmatory 1 / 0 / 17 SAR analysis of small molecule agonists of the Angiotensin II Receptor Type 1 to assess selectivity of uHTS small molecule agonists hits of the APJ receptor - Set 2
488994 confirmatory 0 / 0 / 10 SAR analysis of antagonists of Angiotensin II Receptor Type 1 to assess selectivity of uHTS small molecule antagonists hits of the APJ receptor - Set 2
492982 confirmatory 0 / 0 / 3 SAR analysis of small molecule agonists of the Angiotensin II Receptor Type 1 to assess selectivity of uHTS small molecule agonists hits of the APJ receptor - Set 3
492984 confirmatory 0 / 0 / 7 SAR analysis of antagonists of Angiotensin II Receptor Type 1 to assess selectivity of uHTS small molecule antagonists hits of the APJ receptor - Set 3
493202 confirmatory 0 / 0 / 7 SAR analysis of small molecule agonists of the Angiotensin II Receptor Type 1 to assess selectivity of uHTS small molecule agonists hits of the APJ receptor - Set 4
504438 confirmatory 0 / 0 / 8 SAR analysis of antagonists of Angiotensin II Receptor Type 1 to assess selectivity of uHTS small molecule antagonists hits of the APJ receptor - Set 4
More...

Gene RIF (895)

PMID Text
26975580 Findings suggest that angiotensin II type I receptor (AGTR1) plays a significant role in tumor aggressiveness, and its inhibition may have therapeutic implications.
26782590 The AGTR1 gene A1166C polymorphism may not be correlated with IgA nephropathy susceptibility.
26681690 AT1R mRNA is regulated by TIA-1 in a ER stress-dependent manner.
26675563 No difference in the overall post-heart transplant survival and freedom from acute cellular and antibody-mediated rejection between anti-AT1R-negative and anti-AT1R-positive Heart Mate II bridged recipients.
26658476 Data suggest that CpG dinucleotides CpG1 hypomethylation in the angiotensin II type 1 receptor (AGTR1) promoter is likely associated with the risk of essential hypertension (EH) in the population assessed.
26626074 Our results suggest that silencing of AT1R inhibits EMT induced by HG in HK-2 cells via inactivation of mTOR/p70S6K signaling pathway.
26588355 rs699 in the AGT gene and rs5186 in the ATR1 gene were not associated with the risk and clinical outcomes of IgAN.
26524813 the AT1R Al166C polymorphism was significantly associated with the pregnancy-induced hypertension, especially in Asian subjects (Meta-Analysis)
26420482 analysis of crystal structure of the human AT1R in complex with an inverse agonist olmesartan (Benicar(TM)), a highly potent anti-hypertensive drug
26366788 Our findings indicate that epidermal growth factor, interleukin-1beta and angiotensin II receptor, type 1 may play important roles in the pathogenesis of endometriosis.
More...

AA Sequence

MILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNL      1 - 70
ALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRR     71 - 140
TMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFLFPFLI    141 - 210
ILTSYTLIWKALKKAYEIQKNKPRNDDIFKIIMAIVLFFFFSWIPHQIFTFLDVLIQLGIIRDCRIADIV    211 - 280
DTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTK    281 - 350
KPAPCFEVE                                                                 351 - 359
//

Text Mined References (812)

PMID Year Title
26975580 2016 Overexpression of angiotensin II type 1 receptor in breast cancer cells induces epithelial-mesenchymal transition and promotes tumor growth and angiogenesis.
26782590 2015 Association between the AGTR1 A1166C polymorphism and risk of IgA nephropathy: a meta-analysis.
26681690 2016 Endoplasmic reticulum stress increases AT1R mRNA expression via TIA-1-dependent mechanism.
26675563 2016 The impact of angiotensin II type 1 receptor antibodies on post-heart transplantation outcome in Heart Mate II bridged recipients.
26658476 2015 Association of AGTR1 Promoter Methylation Levels with Essential Hypertension Risk: A Matched Case-Control Study.
26626074 2016 Silencing of angiotensin II type-1 receptor inhibits high glucose-induced epithelial-mesenchymal transition in human renal proximal tubular epithelial cells via inactivation of mTOR/p70S6K signaling pathway.
26588355 2015 Lack of Association Between Polymorphisms in AGT and ATR1 and IgA Nephropathy in a Chinese Population.
26524813 2015 AT1R A1166C polymorphism and risk of pregnancy-induced hypertension: a meta-analysis of case control studies.
26460884 2015 G protein-coupled receptors directly bind filamin A with high affinity and promote filamin phosphorylation.
26420482 2015 Structural Basis for Ligand Recognition and Functional Selectivity at Angiotensin Receptor.
More...