Property Summary

Ligand Count 26
NCBI Gene PubMed Count 60
PubMed Score 267.57
PubTator Score 234.60

Knowledge Summary

Patent (11,079)


  Disease (5)

Disease Target Count Z-score Confidence
Memory Disorders 40 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.9e-11
Breast cancer 3578 1.8e-07
osteosarcoma 7950 3.4e-07
psoriasis 6694 2.4e-04
medulloblastoma, large-cell 6241 3.0e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 4.572 2.3
Nance-Horan syndrome 25 3.291 1.6


  Differential Expression (5)

Disease log2 FC p
Breast cancer -1.700 1.8e-07
medulloblastoma, large-cell 1.100 3.0e-04
osteosarcoma 2.204 3.4e-07
ovarian cancer 1.300 1.9e-11
psoriasis 1.500 2.4e-04

Gene RIF (44)

AA Sequence

TGRSTTCMTSLKSTNPSVATFSLINGNICHERYV                                        351 - 384

Text Mined References (61)

PMID Year Title