Property Summary

NCBI Gene PubMed Count 58
Grant Count 115
R01 Count 45
Funding $13,993,925.02
PubMed Score 248.30
PubTator Score 234.60

Knowledge Summary

Patent (11,079)

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.500 0.000
osteosarcoma 2.204 0.000
medulloblastoma, large-cell 1.100 0.000
ovarian cancer 1.300 0.000
Breast cancer -1.700 0.000

Synonym

Accession P30550 B2R910 GRP-R
Symbols BB2
BB2R

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (42)

PMID Text
25630799 GRP-R regulates glucose metabolism in neuroblastoma by modulating HIF-1alpha, PDK4 and PDP2.
24958816 a key mechanism for GRPR-regulated colon cancer cell migration through the Galpha13-PRG-RhoA-ROCK pathway.
24912045 No association of 16 GRP and 7 GRPR variants were found with agoraphobia with/without panic disorder.
24747971 BBS caused a significant increase in Shh gene transcription and protein secretion that was dependent on BBS-induced GPCR/Galphaq-//Rho mediated activation of nuclear factor kappaB (NFkappaB), which can stimulate a NF-kappaB response element in the Shh gene promoter
24377816 GRPR expression was more pronounced in an advanced-stage lung cancer
23958544 GRPR is highly expressed in epidermoid carcinoma of the anal canal, suggesting this receptor might have a role in anal carcinogenesis.
23889963 integrin ss1 subunit critically regulates GRP-R-mediated neuroblastoma cell migration and invasion
23155231 Protein kinase C is critically responsible for rapid VEGF secretion by gastrin-releasing peptide receptor signaling in neuroblastoma cells
22735756 These findings highlight the role of GRPR signaling in sepsis outcome.
22431275 Elevated buccal GRPR espression was significantly associated with squamous cell carcinoma of the head and neck.
More...

AA Sequence

MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLIGNITLIKIFCTVKS      1 - 70
MRNVPNLFISSLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQLTSVGVSVFTLTALSADRYK     71 - 140
AIVRPMDIQASHALMKICLKAAFIWIISMLLAIPEAVFSDLHPFHEESTNQTFISCAPYPHSNELHPKIH    141 - 210
SMASFLVFYVIPLSIISVYYYFIAKNLIQSAYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPN    211 - 280
HVIYLYRSYHYSEVDTSMLHFVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLIIRSHS    281 - 350
TGRSTTCMTSLKSTNPSVATFSLINGNICHERYV                                        351 - 384
//

Text Mined References (59)

PMID Year Title
25630799 2015 Silencing gastrin-releasing peptide receptor suppresses key regulators of aerobic glycolysis in neuroblastoma cells.
24958816 2014 G?13/PDZ-RhoGEF/RhoA signaling is essential for gastrin-releasing peptide receptor-mediated colon cancer cell migration.
24912045 2014 Analysis of gastrin-releasing peptide gene and gastrin-releasing peptide receptor gene in patients with agoraphobia.
24747971 2015 Cross talk between the bombesin neuropeptide receptor and Sonic hedgehog pathways in small cell lung carcinoma.
24377816 2014 Gastrin-releasing peptide receptor expression in lung cancer.
23958544 2014 Expression of gastrin-releasing peptide receptor in epidermoid carcinoma of the anal canal.
23889963 2013 Integrin ?1 is critical for gastrin-releasing peptide receptor-mediated neuroblastoma cell migration and invasion.
23155231 2012 Protein kinase C regulates bombesin-induced rapid VEGF secretion in neuroblastoma cells.
22735756 2012 Gastrin-releasing peptide receptor antagonism induces protection from lethal sepsis: involvement of toll-like receptor 4 signaling.
22431275 2013 Elevated gastrin-releasing peptide receptor mRNA expression in buccal mucosa: association with head and neck squamous cell carcinoma.
More...